(data stored in ACNUC1104 zone)

EMBL: AM420293.PE208

AM420293.PE208       Location/Qualifiers
FT   CDS_pept        247054..247629
FT                   /transl_table=11
FT                   /locus_tag="SACE_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99563"
FT                   /db_xref="UniProtKB/TrEMBL:A4F689"
FT                   /protein_id="CAL99563.1"
FT                   /translation="MKRLIAPVAVALLLGLTGCAGSNGADTIAPADVAGESSGETQNQQ
FT                   SAGEQQASTGSGTVKFGESVEFAPEADTALKVTLQAPTDQSALETMVPAEGKYVYIAAE
FT                   AVLTDGIMGVVSGDEFTLVDGEGNRYEQAAATLDDMFLEMLAPNGEPGTGMIVYDVPEG
FT                   TDLSSLKVEWEATDSSDKPVGIGGTWTA"
     ttgaaaaggc tgatcgcgcc tgttgcggtc gcgttgctgc tcgggctgac cggatgcgcc        60
     ggttcgaacg gcgccgacac cattgccccg gctgacgtcg cgggcgagag cagcggcgaa       120
     acccagaacc agcagtccgc cggcgagcag caggcgtcca ccggctccgg caccgtgaag       180
     ttcggcgagt ccgtcgagtt cgcgcccgag gccgacaccg ccctcaaggt caccctccag       240
     gcgccgaccg accagagcgc cctcgagacg atggtcccgg ccgagggcaa gtacgtctac       300
     atcgccgccg aggccgtgct caccgacggc atcatgggcg tcgtcagcgg tgacgagttc       360
     accctggtcg acggcgaggg caaccgctac gagcaggcgg cggcgaccct cgacgacatg       420
     ttcctggaga tgctcgcccc caacggcgag cccggcaccg gcatgatcgt ctacgacgtg       480
     cccgagggca ccgacctctc gtcgctcaag gtcgagtggg aggccaccga cagcagcgac       540
     aagccggtcg gcatcggcgg cacctggacc gcctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page