(data stored in ACNUC1104 zone)

EMBL: AM420293.PE209

AM420293.PE209       Location/Qualifiers
FT   CDS_pept        248109..248873
FT                   /transl_table=11
FT                   /locus_tag="SACE_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99564"
FT                   /db_xref="GOA:A4F690"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A4F690"
FT                   /protein_id="CAL99564.1"
FT                   /translation="MVGALVLTGCAGQPQLPGTPPPLVMVPDTIAAHELAALPESTTFG
FT                   DLAAAPSDPAPQSETTGVVVRVKQDLAVYDAPHGRAFARLPATQLANPTWVPAIAEREG
FT                   WAQVLLPSRPNGSTGWVWLGGPERTEKARSPYVVDVDVDKRRLVLRENGVETASWDVSV
FT                   GAPASPTPRGRTFIMAAIEETVTRYSPIILPLGTHSETFSTYGGGPGTVALHGWPDASV
FT                   FGQDRSDGCVRVPPDALRTLTSLPLGTLVLLR"
     gtggtcggcg cgctggtgct gaccggatgc gccggtcagc cccagctgcc gggcaccccg        60
     cccccgctgg tgatggtgcc cgacacgatc gcggcgcacg agttggccgc tctcccggaa       120
     tccaccacgt tcggcgatct cgccgccgcc ccctcggacc cggcacccca gtcggagacg       180
     acgggtgtgg tggtgcgtgt caagcaggac ctggcggtgt acgacgcacc gcacggccgg       240
     gctttcgccc ggctgcccgc gacccagctc gcgaatccga cctgggtccc ggccatcgcc       300
     gagcgcgagg gctgggcgca ggtcctgctg ccctcccggc cgaacggctc cacgggatgg       360
     gtgtggctgg gcggtccgga gcggaccgag aaggcgcggt cgccctacgt cgtcgacgtc       420
     gatgtcgaca agcggcggct ggtgctccgg gagaacggcg tcgagaccgc ctcctgggac       480
     gtcagcgtgg gcgcaccggc ttccccgacc ccgcgcgggc gcaccttcat catggccgcc       540
     atcgaggaga ccgtgaccag gtacagcccg atcatcctgc ctctcggcac gcattcggag       600
     acgttcagca cctacggcgg cggccccgga acggtggcgc tgcacggttg gccggacgcg       660
     tcggtgttcg gccaggaccg cagcgacggg tgcgtgcggg tgcccccgga cgcactacgg       720
     acgttgacgt cgttaccgct gggcacgctc gtgctcctgc ggtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page