(data stored in SCRATCH zone)

EMBL: AM420293.PE21

AM420293.PE21        Location/Qualifiers
FT   CDS_pept        35138..42106
FT                   /transl_table=11
FT                   /locus_tag="SACE_0023"
FT                   /product="beta-ketoacyl synthase"
FT                   /function="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratases"
FT                   /EC_number="4.2.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99376"
FT                   /db_xref="GOA:A4F5Q2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q2"
FT                   /protein_id="CAL99376.1"
FT                   /translation="MSSGTPIAVVGMSCLLPGASTPEEFWASLREGADQRSHGGREVFG
FT                   TDPSVPGGWGDDQHSITTTRGGFVGEVETDLEGLGLPAEELDGLGRVVRWPLHTARRAL
FT                   ADAGLPESGEGLARTGLVLGNYSFPTEESTRFVLPMLRAQVSDGLRRAGLPLPDDASPR
FT                   PDADPRSVWASGLPACVVHTALGLGGPHLALDAACSSTLYGIALARDYLLTGAADVMLA
FT                   GAVCAPDPLLIQLSFSDLRALPSDDDVSQPFDARSSGIVTGQGAGAFVLKRLPDALADG
FT                   DRVHAVVESIGLGNDGAGRHVLSPDAAGQLDAYRAAYADVDPATVDYVECHATGTPLGD
FT                   STELRSLSEFFDGRGSAPLLGSVKGNVGHLLTAAGLTSMLKVIMAMREGRIPATPGVGE
FT                   ALSPSGGEAAARRVVLEERAWPETAGRPRRAGVSAFGFGGTNAHLVLSSEPGPEPSRHA
FT                   PSRRVPRMAVTGVGARLGPLETTAPLQRKVRRAESGLRERPAGRWYGADDIAEPPGELG
FT                   ESGYAEQLKVDLSTYRIPPFELNQANPQHLMMFEAADAALADAGFDQPEETSGAERRPA
FT                   RRVAVVVAMEMEPHTHTHRARFDIGAHVRAECARAGVELGGEVLKRLERSVRDAVHEPI
FT                   GANEVLSYIGNIMSSRISASRNLVGPSFTISADRTAGARAVEIAGLLLLDESIEAVVVG
FT                   GVDLACGPANVNARARLADERGEELPPLGDGAAAVVLTRAGQVGPEGQEYATVDSVSLR
FT                   PDPGSAAREALRAAGSDASEVDYLELGSATSDGLATEVAELAGAYRADDLSCAVGGLAP
FT                   LVGDTQAGCAVASLVKVALCLDGAELPATPAEPPLAGPELAESAFYRVDEPRPWLRRHR
FT                   DGRRIAALSAVGSGTAAHLVLSSGQVATGDAVRTAHVAGPLVLALSADDAEGIAEQAAR
FT                   CAAELDSGGDALALCWEHAHGAQSARLTAVLVSDSGDGLREELRSAERDLPAAVADGEW
FT                   STPAGSFCTGRPLGPQGRVALVYPGAFTTYPGAGREMFRLFPELLADFEAECEHPAERF
FT                   KHRELYPRAREPLDRRTLLRHEAELLDDIPVMLATGTNFAVLATRMLRDVLGVRPDGGF
FT                   GYSLGESSMLFATGVWSAQARDDTALAASPLFRDELRGPKRQVRRSWDLAPETADSAVW
FT                   STHVLLADPETVRGHMRELDRVFLTHVNTPEEVVVAGDPGQCRALVERVGCQAAKAPAN
FT                   HVMHVPLVDPHLDALAALNDYPLGDPDPGLELLSAYDYEPVDFADRGRIAERIARTLRG
FT                   PIDFARLARTAHERGFRYFVEVGPGSTCTRWIDDTLDGREHVAVSLDRRGAPAGASLAR
FT                   AVARLVSHGMRVDLTRLLGMPDSTAQAPTTHVVPCGGESVVERVREAAEPVLHAAVQAE
FT                   DRDAGPADDEAITIEREPFVHLTTVTHAVPTQRGAPPARQHGQRSSPPEQRRAPGPVQA
FT                   IAATVGRAHRSALRTQAALQECALRELERTEPDASGNGSAHGTEPPAADPGGPADPPSG
FT                   GPTGGRPGVVWGESDLLEFAQGRISEVFGPSYAEIDSYPVRVRLPAPPYLFVSRVTDLD
FT                   ARPGQYEPSSLTTEYDVPDDPWYAVDGLVPCAVTIEAGQCDMLLISYLGIDFRNRGERV
FT                   YRLLDSSLVFHGDLPRRGQTLRYEIGIDRFVSTGDRLLFFFDYRCYADGELILELLEAS
FT                   AGFFSREELDESLGIVETDADRRRREAMTPSDFKPLARTGRTSLTAADLRLLAQGRPGE
FT                   VFGPSWDQSADGFNPSLRLPGDALRMIDEMPRIERQGGPRELGDLAAVKHLDPDGWYFE
FT                   CHFPGDPVLAGSLVAEGGVQILQVYAMYLGLHLVLPDAEFQSVPGLRTEVKVRGQITPQ
FT                   TPRIDYHVEITEITMLPRPTVIADITVYDGDKPIVAMRDFGVQVREKPGTPYRPGAGGV
FT                   PEVRPRRNESGEAAFINELHLAHAAKGHLGTAMGPEFDVYDDRRAPHIPNGDFRFVDRI
FT                   MRLDGTRGRLEPGVSMATEYDCPPEAWFHREAAVEDIPNCVYMETSLQAAILLGYYLGA
FT                   TLEHPHQELSIRNLDGNAELVKRVDLRGRTIRHETTMLSSGTATGAILQRFRYELSADG
FT                   EVFYRGESLFGYFTEQALANQVGLDSGSHVAPWLDRQTDIDPARVRTVPVRSDERWFTP
FT                   RDGLRLSGGHLRLVDEVDLVEDGGEHGRGYLRGRREIDPHEWYFDCHFHRDPVMPGSLG
FT                   VEAVIQALHLYVLETGLAGHLGEATFATPVDERMEWKYRGQILRTDGEMTFDAHITDVR
FT                   VDDDRVVVVADANVWKPGLRIYELTGVAVQARRVS"
     atgtccagcg gtacaccgat cgccgtcgtc gggatgtcgt gcctgctgcc gggcgcgagc        60
     acccccgagg agttctgggc gagcctgcgg gagggcgccg accagcgcag ccacggtggt       120
     cgcgaggtgt tcggcaccga cccgagcgtg cccggcggat ggggcgacga ccagcactcg       180
     atcacgacga cccgcggcgg tttcgtcggc gaggtcgaga ccgacctgga aggtctcggc       240
     ctgcccgccg aggagctcga cggtctcggc cgggtcgtgc gctggcccct gcacaccgcc       300
     cggcgggcgc tggccgacgc cgggctgccg gagtccggcg aaggcctcgc ccgcactggc       360
     ctggtgctgg gcaactactc gttcccgacc gaggagtcca cgcgcttcgt gctgccgatg       420
     ctgcgcgcgc aggtcagcga cgggctgcgc cgcgcgggac tgccgctgcc cgacgacgcg       480
     tccccgcggc ccgacgccga tccgcgcagc gtgtgggcca gcggcctgcc cgcctgtgtg       540
     gtgcacaccg cgctggggct cggaggaccg cacctggcgc tggacgcggc gtgctcgtcc       600
     accctctacg gcatcgcgct cgcccgcgac tacctgctca ccggtgcggc cgacgtgatg       660
     ctggccggcg ccgtgtgcgc gccggacccg ctgctgatcc agctctcctt ctccgacctg       720
     cgcgccctgc cctccgacga cgacgtcagc cagccgttcg acgcgcgctc ctccggcatc       780
     gtgaccggcc agggcgcggg cgcgttcgtg ctcaagcggc ttcccgacgc gctggccgac       840
     ggcgaccgcg tccacgccgt ggtcgagtcg atcggtctcg gcaacgacgg tgcgggcagg       900
     cacgtgctca gcccggacgc ggcggggcag ctcgacgcct accgcgccgc ctacgccgac       960
     gtcgatccgg ccaccgtgga ctacgtcgag tgccacgcga ccggcacacc gctcggggac      1020
     tccacggagc tgcgcagcct cagcgagttc ttcgacggac gcgggagcgc gccgctgctg      1080
     ggctcggtca agggcaacgt gggacacctg ctcaccgccg ccgggctgac cagcatgctc      1140
     aaggtcatca tggcgatgcg ggagggccgg atccccgcga cgccgggcgt cggcgaagcg      1200
     ctgagcccgt cgggaggtga ggccgccgcc cggcgcgtgg tgctcgagga gcgcgcgtgg      1260
     ccggaaaccg cgggtcgtcc gcgccgcgcg ggggtgtcgg cgttcggctt cggcggcacc      1320
     aacgcgcacc tggtgctctc ctccgagccc ggtccggagc cttcgcggca cgcaccgtcg      1380
     cggcgggttc cccgcatggc cgtcaccggc gtgggcgcca ggctgggtcc gctggagacg      1440
     accgcgccgc tccagcgcaa ggtgcgccga gcggagagcg gcctgcggga acgcccggcc      1500
     ggccgttggt acggcgcgga cgacatcgcg gagccgcccg gtgagctcgg cgagtcgggc      1560
     tacgccgagc agctcaaggt cgacctctcc acctaccgca tcccgccgtt cgagctgaac      1620
     caggcgaacc cgcagcacct gatgatgttc gaggccgccg acgccgcgct cgccgacgcc      1680
     gggttcgacc aaccggagga gacctccggc gccgagcggc gaccggcccg ccgcgtcgcg      1740
     gtggtcgtgg cgatggagat ggagccgcac acccacaccc accgcgcgcg cttcgacatc      1800
     ggcgcgcacg tccgcgccga atgcgcgcgg gcgggagtcg agctcggcgg cgaggtccta      1860
     aagcgcctgg agcggtcggt gcgcgacgcc gtgcacgagc cgatcggcgc caacgaggtg      1920
     ctctcctaca tcggcaacat catgtccagc cggatctccg cgtcgcgcaa cctggtcgga      1980
     ccgtcgttca cgatctccgc cgaccgcacc gcgggcgcgc gtgcggtgga gatcgccggt      2040
     ctgctgctgc tcgacgagag catcgaggcc gtcgtcgtgg gcggcgtgga cctggcctgc      2100
     ggaccggcca acgtcaacgc ccgcgcacgg ctcgccgacg agcgcggcga ggagctgccg      2160
     ccgctgggcg acggcgcggc ggcggtcgtg ctgacccgcg ccgggcaggt cggcccggag      2220
     ggtcaggagt acgccacggt cgactcggtc agcctgcggc cggaccccgg gtccgctgct      2280
     cgcgaagccc ttcgcgccgc gggctcggac gcatccgagg tggactacct ggagctggga      2340
     tcggcgacct cggacgggct cgccaccgag gtcgccgagc tggccggggc ctaccgcgcc      2400
     gacgacctgt cctgcgccgt cggcgggctg gcgccgctgg tcggcgacac gcaggccggt      2460
     tgcgcggtcg cgtcgctggt gaaggtcgcg ctgtgcctgg acggggcaga actgcccgcg      2520
     accccggccg agccgccgct cgccggaccc gagcttgccg agagcgcctt ctaccgcgtg      2580
     gacgagccgc gcccgtggct gcgccgccac cgcgacggcc gcaggatcgc cgcgctgagc      2640
     gcggtcggca gcggcaccgc cgcgcacctg gtcctgtcgt cggggcaggt ggccaccggc      2700
     gacgcggtgc gcacggccca cgtcgccgga ccgctggtgc tcgcgctctc cgccgacgac      2760
     gccgaaggga tcgccgagca ggccgcccgg tgcgccgccg agctcgactc cggcggcgac      2820
     gcgctcgcgt tgtgttggga gcacgcgcac ggcgcgcaga gcgcgaggct gacggcggtg      2880
     ctggtgtcgg acagcggcga cgggttgcgc gaggaactgc gcagcgccga gcgagacctg      2940
     cccgccgcgg tcgccgacgg cgagtggagc acgccggcgg gcagcttctg caccggccgg      3000
     ccgctgggac cgcagggccg cgtcgcgctg gtctaccccg gtgcgttcac gacctatccg      3060
     ggggcggggc gcgagatgtt ccgcctgttc cccgagctgc tcgccgactt cgaggccgag      3120
     tgcgagcacc ctgccgagcg cttcaagcac cgcgagctct acccgcgggc gcgggagccg      3180
     ctcgaccggc gcacgttgct gcgccacgag gccgagctgc tggacgacat cccggtcatg      3240
     ctcgccaccg gcaccaactt cgcggtgctg gccaccagga tgctgcggga cgtgctgggt      3300
     gtgcggccgg acggcgggtt cggctacagc ctcggcgaga gcagcatgct cttcgcgacc      3360
     ggggtgtggt cggcgcaggc ccgcgacgac accgcgctcg cggccagtcc gctgttccgg      3420
     gacgagctgc gcggccccaa gcggcaggtg cggcggagct gggacctcgc tccggagacg      3480
     gcggactcgg ctgtctggtc cacccacgtc ctgctggccg accccgaaac cgtgcgcggc      3540
     cacatgcgcg agctggaccg ggtcttcctc acccacgtca acacgccgga ggaagtcgtg      3600
     gtcgcgggtg atccgggcca gtgccgcgcg ctggtcgagc gggtgggctg ccaggcggcc      3660
     aaggcgcccg cgaaccacgt gatgcacgtg ccgctggtcg atccgcacct ggacgcgctg      3720
     gccgcgctca acgactaccc gctcggcgat cccgatcccg ggctggagct gctgtcggcc      3780
     tacgactacg aaccggtgga cttcgccgac cgcggtcgca tcgccgagcg gatcgcccgg      3840
     accctgcgcg gacccatcga cttcgcccgg ctggcccgga ccgctcacga gcgcgggttc      3900
     cgctacttcg tcgaggtggg gcccggatcg acgtgcaccc ggtggatcga cgacaccctc      3960
     gacgggcggg agcacgtcgc ggtgtcgctg gaccgccgcg gcgcaccggc cggcgcctcg      4020
     ctggccaggg cggtggcccg gctggtcagc cacgggatgc gggtggacct gacgcggctg      4080
     ctggggatgc ccgactccac cgcccaggcc ccgacgaccc acgtcgtgcc ctgcggcggc      4140
     gagtccgtgg tggagcgggt tcgcgaggcg gccgagccgg tcctgcacgc cgctgtgcag      4200
     gcggaggacc gagacgcggg gccggccgac gacgaggcga tcaccatcga gcgcgagccg      4260
     ttcgtgcacc tcacgacggt gacgcacgcc gttcccaccc agcgcggtgc accgccggcg      4320
     cggcagcacg ggcaacggtc gtcgccgcct gaacagcggc gcgctcccgg gccggtgcag      4380
     gcgatcgcgg ccaccgtcgg acgtgcgcac cgcagcgcgc tgcgcacgca ggccgcgctg      4440
     caggaatgcg cgctgcgcga gctggaaagg acggaaccgg acgcgagcgg caacggctca      4500
     gcccacggca ccgagccgcc cgcggcagac cccggtgggc ccgccgatcc cccgtcgggc      4560
     gggcccaccg gaggtcgtcc gggcgtcgtg tggggcgagt ccgacctcct ggagttcgcc      4620
     cagggacgca tcagcgaggt tttcggccct tcctacgccg agatcgactc ctacccggtg      4680
     cgggtgcggc tgcccgcccc gccgtacctg ttcgtcagcc gcgtgaccga cctcgacgca      4740
     cgcccggggc agtacgaacc ctcctcgctg accaccgagt acgacgtccc ggacgacccc      4800
     tggtacgcgg tggacggcct ggtgccctgc gcggtgacga tcgaggccgg ccagtgcgac      4860
     atgctgctga tcagctacct gggcatcgac ttccgcaacc gcggcgaacg ggtgtaccgg      4920
     ctgctggaca gcagcctggt cttccacggc gacctgccgc ggcggggcca gacgctgcgc      4980
     tacgagatcg gcatcgaccg cttcgtgtcc accggcgacc ggctgctgtt cttcttcgac      5040
     taccgctgct acgccgacgg cgagctgatc ctggagctgc tggaggcgtc cgccgggttc      5100
     ttcagccgcg aggagctgga cgagtcgctg ggcatcgtcg agaccgacgc cgaccgcagg      5160
     cgccgcgagg cgatgacgcc gagcgacttc aaacccctgg cccgcaccgg ccgcacctcg      5220
     ctgacggccg ccgacctgcg gctgctcgcg cagggccgcc ccggcgaggt cttcgggccg      5280
     agctgggacc agtccgccga cggcttcaac ccgtcgctgc ggctgcccgg cgacgcgctc      5340
     cgcatgatcg acgagatgcc gcggatcgaa cggcagggtg gaccgcgcga gctgggtgac      5400
     ctggcggcgg tcaagcacct cgatccggac ggctggtatt tcgagtgcca tttcccgggt      5460
     gatccggtgc tggccggatc gttggtggcc gagggcggcg tgcagatcct gcaggtctac      5520
     gccatgtacc tcggactgca cctggtgctg cccgacgcgg agttccagtc ggtgcccggg      5580
     ctgcggaccg aggtcaaggt gcgcgggcag atcaccccgc aaaccccgcg catcgactac      5640
     cacgtcgaga tcaccgagat caccatgctg ccgcgcccga ccgtgatcgc cgacatcacc      5700
     gtctacgacg gggacaagcc gatcgtggcc atgcgcgact tcggcgtcca ggtccgggag      5760
     aagccgggca cgccgtaccg ccccggggca ggaggtgtgc ccgaggtgcg gccgaggcgc      5820
     aacgagtccg gcgaggcggc gttcatcaac gagctgcacc tcgcgcacgc ggccaagggc      5880
     cacctgggca ccgcgatggg accggagttc gacgtctacg acgaccggcg cgcgccgcac      5940
     atccccaacg gcgacttcag gttcgtcgac cggatcatgc ggctggacgg cacgcgcggg      6000
     cggctggaac cgggcgtgtc gatggccacc gagtacgact gcccgccgga agcctggttc      6060
     caccgcgagg ccgcggtcga ggacatcccg aactgcgtct acatggagac ctccctgcag      6120
     gccgccatcc tgctcggcta ctacctcggc gcgacgctgg agcacccgca ccaggagctg      6180
     agcatccgca acctggacgg caacgccgag ctggtcaagc gcgtcgacct gcgcggcagg      6240
     actatccggc acgagaccac gatgctctcc agcggcaccg cgaccggggc gatcctgcag      6300
     cgcttccgct acgagctctc cgccgacggc gaggtgttct accgcggcga gtcgctgttc      6360
     ggctacttca ccgagcaggc gctggccaac caggtcggtc tcgactccgg cagccacgtc      6420
     gcaccgtggc tcgaccggca gaccgacatc gaccccgcgc gggtgcgcac cgtcccggtg      6480
     cgctccgacg agcgctggtt caccccgcgc gacgggctgc ggctctccgg cgggcacctg      6540
     cggctggtcg acgaggtcga cctggtcgag gacggcggcg agcacggcag gggctacctg      6600
     cgcggccggc gcgagataga cccgcacgag tggtacttcg actgccactt ccaccgcgac      6660
     ccggtgatgc ccggctcgct cggcgtcgaa gccgtcatcc aggccctgca cctgtacgta      6720
     ctggagaccg ggctcgccgg gcacctgggc gaggcgacct tcgcaacgcc ggtcgacgag      6780
     cggatggagt ggaagtaccg aggccagatc ctgcgcaccg acggcgagat gaccttcgac      6840
     gcgcacatca ccgacgtccg cgtcgacgac gaccgggtgg tcgtggtggc cgacgcgaac      6900
     gtgtggaaac ccggactgcg catctacgag ctcaccggcg tcgccgtgca ggcccgccgc      6960
     gtgagctga                                                              6969
//

If you have problems or comments...

PBIL Back to PBIL home page