(data stored in ACNUC1104 zone)

EMBL: AM420293.PE210

AM420293.PE210       Location/Qualifiers
FT   CDS_pept        248919..249446
FT                   /transl_table=11
FT                   /locus_tag="SACE_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99565"
FT                   /db_xref="UniProtKB/TrEMBL:A4F691"
FT                   /protein_id="CAL99565.1"
FT                   /translation="MHKRFLLGAVALSSGLLATASPALADSVDNDGVNVANGNNVSLLP
FT                   IQLCGNDIAIVGAVVEALSTTDTKCVNAPIVDHPSQETGDVNVVVPPKPKPEHEHHKPK
FT                   PKPKPEFPCAVKPPFLPGQLPCAPAAPGPAAPAPAPSAVSPVSQAQPQVQAAALPTAPA
FT                   PSAVLGHVAVTG"
     atgcataagc gattcctgct cggtgcggtc gccctgagct ccgggctgct ggccaccgcg        60
     agcccggccc tcgccgacag cgtcgacaac gacggagtca acgtcgccaa cggcaacaac       120
     gtcagcctgc tgccgatcca gctctgcggg aacgacatcg cgatcgtcgg ggcggtcgtg       180
     gaggccttgt ccacgacgga cacgaagtgc gtgaacgcgc cgatcgtgga ccacccgagc       240
     caggagaccg gcgacgtcaa cgtggtcgtg ccgcccaagc ccaagccgga gcacgagcac       300
     cacaagccca agcccaagcc caagccggag ttcccgtgcg cggtcaagcc cccgttcctg       360
     ccgggccagc tgccctgcgc accggcggct cccggcccgg ccgcaccggc cccggccccc       420
     agtgccgtga gcccggtgtc gcaggcccag ccgcaggtcc aggccgcggc gctgccgacc       480
     gcgcctgccc cttccgcggt gctcggccac gtcgcggtga ccggctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page