(data stored in ACNUC1104 zone)

EMBL: AM420293.PE218

AM420293.PE218       Location/Qualifiers
FT   CDS_pept        258851..259453
FT                   /transl_table=11
FT                   /locus_tag="SACE_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99573"
FT                   /db_xref="UniProtKB/TrEMBL:A4F699"
FT                   /protein_id="CAL99573.1"
FT                   /translation="MDHHDAVATPRDALRSLAGFCNDRPDRATPPSPAGGVRRSDRSDV
FT                   GCTHAESCPLFPFLKASLRGWREHYCDSEDRWLECARYQVARTGQHVPISLLPNGRDAH
FT                   YLAMAAEESRTAVTEPVRASDLGRAHQHERAAHERAARPEPRSTETTEQFGAVAQPKPP
FT                   PRSPEEPPSEPREPARRRKPEKRGWWRRLADWMRGPA"
     gtggatcacc acgatgccgt ggctacaccg cgcgacgctc tgcgatcgct ggccgggttc        60
     tgcaacgacc gaccggatcg cgccacgccg ccttccccgg ccggtggtgt gcgccggtca       120
     gatcggagtg acgtgggctg tacccacgcc gagagttgtc ctctcttccc gttcctcaag       180
     gccagcctgc gcggctggcg cgagcactac tgcgacagcg aggaccgctg gctcgaatgc       240
     gcccggtacc aggtggcccg cacgggccag catgtgccga tctcgctgct cccgaacggg       300
     cgcgacgccc actacctggc gatggccgcc gaggagtcca ggacggccgt gaccgagccg       360
     gtgcgcgcct ccgaccttgg ccgcgcacac cagcatgaac gcgcggcgca tgaacgcgcg       420
     gcgcgacccg aacccaggtc gaccgagacc acggagcagt tcggcgccgt ggcgcagccg       480
     aagccgccac cgcggtcccc ggaggaaccg ccgtccgaac cacgagaacc cgctcggcgg       540
     cgcaagcccg agaagcgggg ctggtggagg cggctcgccg actggatgag aggtcccgca       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page