(data stored in ACNUC1104 zone)

EMBL: AM420293.PE219

AM420293.PE219       Location/Qualifiers
FT   CDS_pept        259450..260088
FT                   /transl_table=11
FT                   /locus_tag="SACE_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99574"
FT                   /db_xref="GOA:A4F6A0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A0"
FT                   /protein_id="CAL99574.1"
FT                   /translation="MSNYWPWWAGAVGLALVTINYTLITDRSLGVSSAWDRVLHWRAER
FT                   RHERHEARFADEGALADALAAATAEEFGDRSSTQDRGDDVRAQYVGSSAVEATSAASMR
FT                   PVPVVTQAALLLAIFAGGWVAAVTAGRFEVRFDMGAGFRDLVTADPNAMIGLLFAGGLL
FT                   VGFGTRLAGGCSSGHGLSGCGRLRPVSLVATAVFFGTAVLVSFLLWKVV"
     atgagcaact actggccctg gtgggcggga gccgtcggcc tcgcgctcgt caccatcaac        60
     tacaccctca tcaccgaccg gtccttgggt gtgtcgtcgg cgtgggaccg cgtcctgcac       120
     tggcgcgccg aacgacgtca cgaacggcat gaggcccggt tcgccgacga aggtgcgctc       180
     gccgatgcgc tggccgcggc caccgccgag gagttcggcg atcgctcctc gacccaggat       240
     cgcggagacg acgtgagggc gcagtacgtc ggatcctcgg ccgtcgaggc gacctcggcc       300
     gcgagcatgc gcccggtgcc cgtggtgacc caggccgcac tgctgctggc gatcttcgcc       360
     ggcggatggg tggcggcggt gaccgccggc cggttcgagg tccgcttcga catgggcgcc       420
     gggttccgcg atctcgtcac cgcggacccg aacgccatga tcggcttgct gttcgccgga       480
     gggctgctgg tcggcttcgg aacccgcctc gcgggagggt gcagctccgg ccacggactc       540
     agcggctgcg gcaggctgcg cccggtgagc ctcgtcgcga ccgccgtgtt cttcggcacc       600
     gccgtgctgg tgtcgttcct gctgtggaag gtggtctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page