(data stored in SCRATCH zone)

EMBL: AM420293.PE221

AM420293.PE221       Location/Qualifiers
FT   CDS_pept        260664..260906
FT                   /transl_table=11
FT                   /locus_tag="SACE_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99576"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A2"
FT                   /protein_id="CAL99576.1"
FT                   /translation="MGLLQNKPQDLAAKAKQAYDDGRQRFAVRLLDLPSAKDDEVDSWS
FT                   RHIEAIEAAGWIVDHFSTVPSDRGWNHGYVLFMRR"
     atgggactcc tccagaacaa accgcaagac ctcgcagcca aggccaagca ggcttacgac        60
     gacgggcggc agcgcttcgc ggtgcgcctg ctcgacctgc cttcggccaa ggacgacgag       120
     gtggactcct ggtcgcggca catcgaggcg atcgaggcgg ccgggtggat cgtcgaccac       180
     ttctccaccg tgcccagcga ccggggctgg aaccacggct acgtgttgtt catgcgccgc       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page