(data stored in ACNUC1104 zone)

EMBL: AM420293.PE225

AM420293.PE225       Location/Qualifiers
FT   CDS_pept        263328..264521
FT                   /transl_table=11
FT                   /locus_tag="SACE_0228"
FT                   /product="chloramphenicol resistance protein"
FT                   /function="Arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99580"
FT                   /db_xref="GOA:A4F6A6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6A6"
FT                   /protein_id="CAL99580.1"
FT                   /translation="MPLRLLVLAVGTFVINTGSYLVAGVLPSIAGAVGVPVTTAGQLIT
FT                   MHALTYAVSAPVLSTLAGRWERRRLLWVSLGLFVLGNIATAVAPDFASLTAARVLGALG
FT                   ASMFTPTAVVIAADLVPLDRRGRAVSMVLSGLTLATVVGVPMGVLLEGMLGYRGLFWIV
FT                   ALLGVLASVALLALPRVPAPPAARFGERLSVLRDRTVVWVLAVSLLGSLADFAAYTYAS
FT                   PMLSALTGAGAGTLGALLFVYGVAGATGNAVVGRITDRFGSGVGIAGSLLALAAGLALL
FT                   PLAGSATWAVAGLLVLWGLGGWGIMPAIQHRLINLTPASAAVVIAFNSSALYLGMGLGG
FT                   ITGGAVAAAWGWAALGPASAVVSVLALVLFWRLPAPAARAAVPERARPEDVPVGASG"
     atgccgttgc ggctgctggt gctcgctgtc ggcaccttcg tcatcaacac cggttcctac        60
     ctcgtggccg gtgtgctgcc ctcgatcgcc ggtgccgtcg gtgtgccggt caccaccgcg       120
     gggcagctga tcaccatgca cgcgctgacc tacgcggtga gcgcgccggt tctgtccaca       180
     ttggccggac gctgggagcg caggcggctg ctgtgggtct cgctggggct gttcgtgctc       240
     ggcaacatcg ccaccgcggt cgcgcccgac ttcgcctcgc tcaccgccgc ccgggtgctg       300
     ggagccctgg gggcgagcat gttcaccccg accgccgtgg tcatcgcggc ggacctggtc       360
     ccgctggacc ggcgcggtcg cgcggtgtcg atggtcctca gtggactgac gctggccacc       420
     gtcgtcggcg tcccgatggg cgtgctgctg gaagggatgc tcggctaccg cgggctgttc       480
     tggatcgtgg ccctgctcgg cgtcctggcc tcggtggcgc tgctggcgct gccccgggtg       540
     cccgcgccgc ccgcggcccg gttcggcgag cggctgtcgg tcctgcgcga ccggacggtg       600
     gtgtgggtgc tggcggtctc gctgctcggc tcgctggccg acttcgccgc ctacacctac       660
     gcctcgccga tgctgtcggc gctgaccggc gccggtgcgg ggacgctcgg tgcgctgctg       720
     ttcgtctacg gcgtggcggg tgcgacgggc aacgcggtcg tcggccggat caccgaccgg       780
     ttcggctccg gagtcggcat cgccggctcg ctgctcgcgc tggccgccgg cctggcgctg       840
     cttccgctgg ccggttcggc gacctgggcg gtcgccgggc tgctggtgct gtggggcctc       900
     ggcggctggg gcatcatgcc cgcgatccag caccggctga tcaacctgac gccggcgagc       960
     gcggcggtgg tgatcgcgtt caactcctcc gcgctctacc tcggcatggg gctcggcggc      1020
     atcaccggag gcgcggtcgc ggcggcgtgg ggctgggccg cgctcgggcc ggcgtcggcg      1080
     gtggtctcgg tgctggcgct ggtgctgttc tggcgcctgc ccgcgcccgc cgcgcgggcc      1140
     gccgtccccg agcgggcacg tcccgaggac gtgccggtgg gcgcctccgg gtga            1194
//

If you have problems or comments...

PBIL Back to PBIL home page