(data stored in SCRATCH zone)

EMBL: AM420293.PE229

AM420293.PE229       Location/Qualifiers
FT   CDS_pept        267550..268608
FT                   /transl_table=11
FT                   /locus_tag="SACE_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99584"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B0"
FT                   /protein_id="CAL99584.1"
FT                   /translation="MPSSMVTAHEAPLNSSADPARQPDSARPAIGWPPAYFAPGSRLRT
FT                   SASTGSFTLTTSVSHASGACQATWRSTSRTAVSGVATTTSASSAAALRSASSALSSTAK
FT                   PSARAASASGREAVAPHAGRPAAEAARSTEPPISPSPMTHTARMATILPEPPPAGPRTR
FT                   MSGNPSPEGYERAIVLSGGVRTLYGVLMTDQEPVAGFAVAVVREDGRWRCSAMDSSVLA
FT                   GLDTAITELRGLRSTGAVFGMCNVDDEFFVLIRPVPGGVDLLLSDAAAALDYDIAADVL
FT                   DLLRIDPPDEDDDEVWPEGNLAILSDIGLPEGELLVIIEEVDLYPDEQLEMIAQRCGFG
FT                   EQFAGLMEKLDQ"
     gtgccgtcct cgatggtcac cgcccacgag gcgccgctga acagctcggc cgacccggcc        60
     cgccagcccg actcggccag gcccgccatc gggtggcccc cggcgtactt cgcgcccggc       120
     agcaggctgc ggacctcggc ctcgaccggg tccttcacgc tcaccacgtc ggtcagccat       180
     gcctccggcg cgtgccaggc gacctggcgc agcacctcgc ggaccgccgt cagcggcgtg       240
     gcgaccacca cgagcgcgtc ctccgcggcg gccctgcgca gcgcgtcctc cgcgctgtcc       300
     tcgacggcga agccctccgc ccgcgccgcg tcggcgtccg gccgcgaggc ggtcgcgccc       360
     cacgccgggc gtccggcggc ggaggcggcc cgcagcaccg agccgccgat cagtccgagt       420
     ccgatgacgc atacggcacg catggcgacc atcctgccgg agccgccgcc ggcgggccca       480
     cgtacccgga tgagcgggaa tccgagcccg gaaggttacg agcgcgcaat agtgctttcg       540
     ggtggcgttc gcaccctcta cggtgtcctc atgacggacc aggagccggt cgcgggcttc       600
     gccgttgccg tggtgcgtga ggacggccgg tggcggtgca gcgcgatgga cagctcggtg       660
     ctggcggggc tcgacaccgc gatcacggaa ctgcgcgggt tgcgatccac cggcgcggtg       720
     ttcggcatgt gcaatgtgga cgacgagttc ttcgtcctca tccggccggt gcccggcggc       780
     gtcgacctgc tgctgtccga cgcggcggcg gcgctggact acgacatcgc cgccgacgtc       840
     ctcgacctgc tgcgcatcga cccgcccgac gaggacgacg acgaggtgtg gccggagggc       900
     aacctggcca tcctgtccga catcgggctg cccgagggcg agctcctggt gatcatcgag       960
     gaggtcgacc tgtacccgga cgagcagctg gagatgatcg cccagcgctg cgggttcggg      1020
     gagcagttcg ccggcctgat ggagaagctg gaccagtga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page