(data stored in ACNUC1104 zone)

EMBL: AM420293.PE23

AM420293.PE23        Location/Qualifiers
FT   CDS_pept        43705..45474
FT                   /transl_table=11
FT                   /locus_tag="SACE_0025"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /function="Acyl-CoA dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99378"
FT                   /db_xref="GOA:A4F5Q4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q4"
FT                   /protein_id="CAL99378.1"
FT                   /translation="MTTVNEVAWRGAAGNWTGPYAAAAELDAKLGDPADPDNPCGFAAM
FT                   RGRDECAAFPDALVESAGPALRLSYLPSRHGGELSTMDETLALVRVAARRDITVMPATM
FT                   FSITAAGCVLLAGSEEQRRRVVGLLRGGGAVGFALSEAEHGSDLLSNTCALSRDSEGAP
FT                   RLDGHKWLVGLGRRCDALLVVARSGGRGPAAFSTVLVEGDAVREARTGEQQHPAGMRGI
FT                   DFAGFRFEGAPVPEESVVGETGRGMETAMTAMQLVRTTSAAANLAASDTALRLALDFAT
FT                   EHVVAGSALIDQEHARRELGTAAAAVVACDALALACTRALHTAPAAASLHSSVVKKVLT
FT                   ELSAEVFARCADVLGTRSQLPGAFETARRDNEVVRYVDTGPVANIRQVAAQAARVLAAD
FT                   GSDPDDALAATFALDAPLPEFRLDRLVLSCRRDPFVSALPAVVGRADRALLTSGNGDAA
FT                   ALVRQVAHELAEMGEETGPARDAEDRFEHAERFCYLHAAACCVHLWWFSRHLPLFGGAP
FT                   ESPDWLAAALRLLLDRARGVTTRLPAGLTEPLARHVRALHGSGRLVSAVALPLAESGRA
FT                   HAGTEDDRGRHDG"
     gtgacgacgg tgaacgaggt cgcgtggcgg ggagccgccg ggaactggac ggggccctac        60
     gccgctgccg ccgagctgga cgcgaagctc ggcgatccgg ccgatccgga caacccctgc       120
     gggttcgccg cgatgcgcgg gcgcgacgaa tgcgccgcgt tcccggacgc gctggtcgag       180
     tccgccgggc ccgcgctgcg gctgtcctac ctgccttccc gccacggcgg tgaactgtcc       240
     accatggacg aaaccctggc tctggtgcgc gtcgccgccc ggcgcgacat cacggtcatg       300
     ccggccacga tgttcagcat caccgcggcc gggtgcgtgc tgctggccgg ctccgaagag       360
     caacggcggc gcgtggtcgg cctgctgcgc ggcggcggag cggtcgggtt cgcgctgtcg       420
     gaggccgagc acggcagcga cctgctgtcc aacacctgcg cgctgagccg cgactccgaa       480
     ggcgcgccgc ggctggacgg gcacaagtgg ctggtcgggc tgggccgccg gtgcgacgcg       540
     ctgctggtcg tggcgcgctc cggcggccgc ggtcccgccg ccttctccac cgtcctggtg       600
     gaaggcgacg cggtgcgcga ggcccgcacc ggcgagcagc agcacccggc gggcatgcgg       660
     ggcatcgact tcgccgggtt ccggttcgaa ggcgcgcccg tgccggagga gtcggtggtc       720
     ggcgagaccg gacgcggcat ggagaccgcg atgacggcca tgcaactggt gcgcacgacc       780
     agcgcggcgg ccaacctcgc cgcgagcgac accgcgctgc ggctggcgct ggacttcgcc       840
     accgagcacg tggtggcggg cagcgccctg atcgaccagg agcacgcccg ccgcgagctg       900
     ggcaccgcgg cggcggccgt cgtcgcctgc gacgcgctgg cgctggcgtg cacccgcgcc       960
     ctgcacaccg cgcccgccgc ggccagcctg cactccagcg tggtcaagaa ggtcctcacc      1020
     gagctctcgg cggaggtctt cgcccgctgc gcggacgtgc tcggcacccg cagccagctg      1080
     cccggcgcgt tcgagaccgc gcgacgcgac aacgaggtgg tccgctacgt cgacaccggg      1140
     ccggtggcca acatccggca ggtcgccgcg caggcggcgc gggtgctcgc cgccgacggc      1200
     agcgacccgg acgacgcgct cgccgccacc ttcgcgctcg acgcgccgct tcccgagttc      1260
     cggctcgacc ggctggtgct ctcctgccgc cgcgacccct tcgtctccgc gttgcccgcg      1320
     gtggtggggc gtgccgaccg cgccctgctg acctccggga acggcgacgc ggcggcactc      1380
     gtgcgccagg tggcccacga actcgcggag atgggagagg aaacgggccc ggcccgcgac      1440
     gccgaggacc gcttcgagca cgcggaacgc ttctgctacc tgcacgcggc cgcctgctgc      1500
     gtgcacctgt ggtggttcag caggcacctg ccgttgttcg gaggagcacc ggagtcgccg      1560
     gactggctgg ccgccgccct gcggctgctg ctcgaccggg cccggggagt caccacccgg      1620
     ctcccagcag ggctgaccga gccgcttgcc cggcacgtga gggcgctgca cggctcgggg      1680
     cggctggtgt cggcggtcgc gctcccgctc gccgagtccg gccgcgcgca cgcgggcacc      1740
     gaggacgacc gagggaggca cgatggctga                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page