(data stored in SCRATCH zone)

EMBL: AM420293.PE231

AM420293.PE231       Location/Qualifiers
FT   CDS_pept        269255..269797
FT                   /transl_table=11
FT                   /locus_tag="SACE_0234"
FT                   /product="RNA polymerase sigma-70 factor, ECF family"
FT                   /function="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99586"
FT                   /db_xref="GOA:A4F6B2"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B2"
FT                   /protein_id="CAL99586.1"
FT                   /translation="MLAARAAAGDEQAFAVFVRRHSDGVFALALRMLGDRVEAEDVVQD
FT                   VFVTVWRRVGELADFGAARAWLFQIARRQCLIVLRRKRIRRTYPVGSVPEHRPAVGAAR
FT                   GVADPQRMAEAGAGVCALGRALAGLPTRQRDVWLLAEVDGLSYVEIGQRVGAGEEAVRG
FT                   RLSRARATLADAMRAWR"
     gtgctggccg cccgggcggc ggcgggcgac gagcaggcgt tcgcggtctt cgtccgtcgc        60
     cattcggatg gcgtgttcgc gctcgcgctg cgcatgctgg gcgaccgggt ggaggccgag       120
     gacgtcgtgc aggacgtctt cgtgaccgtc tggcggcggg tcggcgagct cgccgacttc       180
     ggcgcggccc gcgcgtggct gttccagatc gcgcgcaggc agtgcctgat cgtccttcgc       240
     cggaagcgca tccggcggac ctacccggtg ggctcggtcc cggagcaccg gcccgcggtg       300
     ggggccgcgc gcggggtggc ggacccgcag cggatggccg aggccggcgc gggggtctgc       360
     gcgctcggcc gcgcgctggc cggactgccg acgcggcagc gcgacgtgtg gctgctggcc       420
     gaggtcgacg ggctgtccta tgtggagatc gggcagcgcg tcggggcggg ggaggaggcg       480
     gtgcgcggcc ggctgtcgcg ggcccgcgcc accctggccg acgcgatgcg ggcctggcgc       540
     tga                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page