(data stored in ACNUC1104 zone)

EMBL: AM420293.PE233

AM420293.PE233       Location/Qualifiers
FT   CDS_pept        complement(272048..272542)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99588"
FT                   /db_xref="GOA:A4F6B4"
FT                   /db_xref="InterPro:IPR025325"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B4"
FT                   /protein_id="CAL99588.1"
FT                   /translation="MRFRPPFRHRLPDVSEHGLEAAADIYAQRLRAFYDSRARWHRRFY
FT                   RFSGILVIAVGAGLPILTTQQFPGQDLVISIAGVTVAVSAGLRAFYRWDQSWILLRRTE
FT                   IALTDAHWQWKAGLGADPVANAENTQRFLEELGSLRRQESDSFFQDLSFPGSAEASRPQ
FT                   H"
     atgaggttcc gcccgccgtt ccgccaccgg ctccccgacg tctccgagca cggcctggag        60
     gcggcggccg acatctacgc ccagcggctg cgagccttct acgactcgcg cgcccgctgg       120
     caccggcggt tctaccggtt cagcggaatc ctggtgatcg cggtcggcgc ggggctgccg       180
     atcctgacga cccagcagtt ccccgggcag gacctggtca tctcgatcgc cggtgtcact       240
     gtcgcggtgt cggcgggcct gcgcgccttc taccgctggg accagtcgtg gatcctcctg       300
     cgccgcaccg agatcgccct gaccgacgcg cactggcagt ggaaggccgg gctcggcgcc       360
     gacccggtcg ccaacgccga gaacacccag cggttcctgg aggagctcgg gtcgctgcgg       420
     cggcaggagt ccgactcctt cttccaggac ctgtcattcc ccggctccgc cgaggcttcc       480
     cgcccgcagc actga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page