(data stored in SCRATCH zone)

EMBL: AM420293.PE236

AM420293.PE236       Location/Qualifiers
FT   CDS_pept        complement(276265..276591)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99591"
FT                   /db_xref="GOA:A4F6B7"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B7"
FT                   /protein_id="CAL99591.1"
FT                   /translation="MTPLDITGRALAMLAALALLTAAAAAVVLWRAVLPVILIAALAVT
FT                   SGMVRTLALGGFAALAGLRGLMLALDRAGTAVPTPRLRRSPPAWIPQTAGAGHEPGNEH
FT                   PATE"
     atgaccccgt tggacatcac cggccgcgcg ctggccatgc tcgccgccct cgccctgctc        60
     accgccgcag ctgccgccgt cgtgctctgg cgcgcggtcc tgcccgtgat cctcatcgcc       120
     gccctggcgg tgacctccgg aatggtgcgc accctcgccc tcggcggctt cgccgcactg       180
     gccggactcc gcggcctcat gctcgccctc gaccgcgcgg gcaccgccgt acccacaccc       240
     cgactccgac gctcgccgcc tgcctggata cctcagaccg ccggtgccgg ccatgagccc       300
     ggcaatgagc accccgccac cgaatga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page