(data stored in ACNUC1104 zone)

EMBL: AM420293.PE237

AM420293.PE237       Location/Qualifiers
FT   CDS_pept        complement(276588..277157)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0240a"
FT                   /note="Xis like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0240a"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99592"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6B8"
FT                   /protein_id="CAL99592.1"
FT                   /translation="MTTAAMSPSRPTPRVGGGAVPAVPAVPPQVSAGRQHALGRHEPSH
FT                   SCKPSQPDQHRDAWDGWDGYPPHPVLPDRGWPVNGPVSPAGASEYPLAIHLPGPLGATC
FT                   ANASPVGKWMPGGSGVDAPIQGGFPPTRPPTHSTTRHQPQPRPGGWVDLVDTPRGDAPA
FT                   RLCRGGPHRPPTRSNRPPSTTPGDPR"
     atgaccaccg ccgccatgtc gcccagtcgg cccactccga gggtgggagg gggtgccgtc        60
     ccagccgtcc cagccgtccc accgcaggtc agcgcgggac ggcaacacgc cctgggacgg       120
     cacgagccgt cccactcctg caagccgtcc cagcctgacc agcaccggga cgcttgggac       180
     ggctgggacg gctacccccc tcaccccgtg ctgccggacc gaggttggcc agtgaacggg       240
     ccagtgagcc cggcaggggc cagtgaatat ccactggcca tccacttgcc cggcccactg       300
     ggcgcgacct gcgcgaacgc gtccccagtg ggcaagtgga tgcccggtgg atcaggggtg       360
     gatgcgccga ttcagggtgg attcccaccg acgcgcccac ccactcactc caccacccgc       420
     caccagccac aaccccgccc aggtggatgg gtggatctgg tggacacccc gcgcggagac       480
     gcccctgcgc ggctgtgccg gggcggcccg caccgtccac ccacccgctc gaaccgcccg       540
     ccctcaacca caccgggaga cccgcgatga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page