(data stored in SCRATCH zone)

EMBL: AM420293.PE240

AM420293.PE240       Location/Qualifiers
FT   CDS_pept        complement(280123..280464)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99595"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C1"
FT                   /protein_id="CAL99595.1"
FT                   /translation="MTASKVPVHGVVTVLYACPLTDAQLRDAEVSDLARFVALVHRTTP
FT                   RKVLGPLEQGLAVLAESGGPSFDRRRYALAQARADAIRALMPAPGRDTSAEPPPVHPVE
FT                   IEPDAIWPN"
     atgaccgcct ccaaggtgcc ggtgcatggc gtggtgacgg tgctctacgc ctgcccgctg        60
     accgacgcgc agctgcgcga cgccgaggtc tccgacctgg cccggttcgt cgccctggtc       120
     caccgcacca caccccgcaa ggtgctggga ccactggaac aagggctggc ggtgctggcc       180
     gagtccggcg ggccgagctt cgaccggcgc cgctacgccc tggcccaggc cagagccgac       240
     gcgatccggg cactcatgcc ggcaccggga cgggacacct cggcagagcc cccgccggtg       300
     catccggtgg agatcgagcc ggacgcgatc tggccgaact ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page