(data stored in ACNUC1104 zone)

EMBL: AM420293.PE246

AM420293.PE246       Location/Qualifiers
FT   CDS_pept        285672..288122
FT                   /transl_table=11
FT                   /locus_tag="SACE_0251"
FT                   /product="putative DNA polymerase III gamma subunit"
FT                   /function="DNA polymerase III, gamma/tau subunits"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99601"
FT                   /db_xref="GOA:A4F6C7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C7"
FT                   /protein_id="CAL99601.1"
FT                   /translation="MALALYRKYRPATFAEVVGQEHVTEPLRTALASGRINHAYLFSGP
FT                   RGCGKTSSARILARSLNCAQGPTADPCGECDSCVALAPEGGGSVDVVELDAASHGGVDD
FT                   TRELRDRAFFAPAQSRYRIFIIDEAHMVTTQGFNALLKIVEEPPEHLIFVFATTEPDKV
FT                   LTTIRSRTHHYPFRLMPPGVMRELLERICDQESVRVEPAVYPLVLRAGGGSARDTLSVL
FT                   DQLLAGAGEEGVTYERAVALLGVTDVALIDDMVDAMAAADGAAVYGTVDRLVEAGHDPR
FT                   RFASDLLDRLRDLVLLNAVPDADQRGLIQASGDELTKMQQQAEQLGAATLSRFAEIVHT
FT                   GLADMRGATAPRLLLELLCARMMLPTVSDSEVALLQRLERVERRMTIAPEGGAAEAPAG
FT                   QPADQDAGGRPRRVFQRPHERAAQAAEQPTQAGQGAQDGQAGQGSQAGQDSRAGQDSRV
FT                   GQGEQPSQAGRQAASDAQPGSPGGQPGPSAAQPGPSAAAGQQSPAGQPTPEASARPAGA
FT                   EAPAPAQPERPAAAEPPGRPAQRAPQARPGAPDAAARDAAAQQRPAAEQQAAQAGASAG
FT                   AHAGRDTADVRRLWTEVLRAVAERNRPTQALLLNATVQDIQSGTLVLSMPTSGLVKQFA
FT                   QQRRLDFVKDALRAVLGGEWEIRCVEAGAAPPAAPSRPAQPPRQAPQRPAEEAPQRKPS
FT                   ADWSANKPNPQQGQGGKPENSQAQRNASQGRQAGNGRRAPADDIPPPPEPPDEEPPPED
FT                   YVPPSRPARQAPPPPPPVDEEEDEEAMMADSTPADEVMASRPDPEEAAVELFASELGAR
FT                   RIDD"
     gtggcgctcg ccctttaccg caagtaccgg ccggcgacct tcgctgaggt cgtcgggcag        60
     gaacacgtca ccgaaccgct gcggaccgcg ctcgcgtccg ggcgcatcaa ccacgcatac       120
     ctgttctccg gcccgcgcgg ctgcggcaag acctccagcg cacgcatcct cgcccgctcg       180
     ctgaactgcg cgcagggccc gaccgccgac ccgtgcggcg agtgcgactc gtgcgtggcg       240
     ctcgcgccgg agggcggcgg cagcgtcgac gtcgtcgagc tggacgcggc cagccacggt       300
     ggtgtggacg acacccgcga gctgcgcgac cgcgcgttct tcgcgccggc ccagtcgcgg       360
     taccggatct tcatcatcga cgaggcccac atggtcacca cgcagggctt caacgccctg       420
     ctgaagatcg tcgaggaacc gccggagcac ctgatcttcg tcttcgccac gacggagccg       480
     gacaaggtgc tcaccaccat caggtcccgg acgcaccact acccgttccg gctgatgccg       540
     cccggcgtca tgcgcgagct gctggaacgg atctgcgacc aggagagcgt gcgcgtcgag       600
     cccgccgtgt acccgctggt gctgcgcgcg ggcggaggct ccgcgcgcga caccctcagc       660
     gtcctggacc agctgctggc cggcgcgggc gaggagggcg tcacctacga gcgcgccgtc       720
     gcgctgctcg gggtcaccga cgtcgcgctg atcgacgaca tggtcgacgc gatggccgcc       780
     gccgacggcg cggcggtcta cggcaccgtg gaccggctgg tggaggccgg gcacgacccg       840
     cgccgcttcg cctccgacct gctcgaccgg ttgcgcgacc tggtgctgct gaacgcggtc       900
     cccgacgccg accagcgcgg gctcatccag gcgtcgggcg acgagctgac caagatgcag       960
     cagcaggccg agcagctcgg agcggcgacc ctgtcgcgct tcgccgagat cgtgcacacc      1020
     ggcctggccg acatgcgcgg tgccaccgcg ccccggctgc tgctcgagct gctctgcgcc      1080
     cggatgatgc tgccgacggt gtcggactcc gaggtcgcgc tgctgcaacg gctcgagcgg      1140
     gtcgagcgcc ggatgaccat agcgccggag ggcggcgcgg ccgaagcgcc cgccggccag      1200
     cccgcggacc aggacgccgg gggacgaccg cggcgggtct tccagcgtcc gcacgagcgt      1260
     gcggcgcagg cagcggagca gccgacccag gccggccagg gcgctcagga cggccaggcc      1320
     ggtcaggggt ctcaggccgg tcaggactcc cgagctggtc aggactcccg ggttggtcag      1380
     ggtgaacagc cttcccaggc cggcaggcag gcggcttcgg acgcgcagcc agggtctccg      1440
     ggcgggcagc ccggcccttc ggccgcacag cccggccctt cggccgcggc cgggcagcag      1500
     tctcccgccg ggcaaccgac gccggaggcg tcggcccggc ccgccggcgc ggaagctccg      1560
     gctccggcgc agccggagcg ccccgcggcg gcggagccgc cggggcggcc cgcgcagcgg      1620
     gcgccgcagg cgcgccccgg cgcgccggac gcggcggcgc gggatgccgc tgcgcagcag      1680
     cggcccgcgg cggagcagca ggccgcgcag gccggggcga gcgcgggagc gcacgcgggg      1740
     cgggacaccg ccgacgtgcg gaggctgtgg accgaggtgc tgcgggcggt cgccgagcgc      1800
     aaccggccga cgcaggcgct gctgctcaac gccaccgtgc aggacatcca gagcggcacg      1860
     ctggtgctgt cgatgccgac gtcgggcctg gtcaagcagt tcgcgcagca gcggaggctg      1920
     gacttcgtca aggacgcgct gcgcgcggtc ctcggcggcg agtgggagat ccgctgcgtc      1980
     gaggccgggg cagcgccgcc ggccgcgccg agccggcccg cccagccgcc ccgccaggcc      2040
     ccgcagcgcc cggccgagga agccccgcag cgcaagccgt cggcggactg gtcggcgaac      2100
     aagccgaacc cccagcaggg gcagggcggc aagccggaga actcgcaggc gcagcgcaac      2160
     gcgtcgcagg gcaggcaggc cggcaacggt cgccgggcgc cggccgacga catcccgccg      2220
     ccgcccgagc cgccggacga ggagcccccg ccggaggact acgtcccgcc gtcgcggccc      2280
     gcccgccagg ccccgccgcc tcctccgccg gtcgatgagg aggaggacga ggaggccatg      2340
     atggccgact cgaccccggc cgacgaggtg atggcctcgc ggcccgatcc ggaggaagcc      2400
     gccgtcgagc tgttcgccag cgagctcggc gcccgccgca tcgacgactg a               2451
//

If you have problems or comments...

PBIL Back to PBIL home page