(data stored in ACNUC1104 zone)

EMBL: AM420293.PE248

AM420293.PE248       Location/Qualifiers
FT   CDS_pept        complement(288411..290231)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0253"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   region"
FT                   /function="Dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99603"
FT                   /db_xref="GOA:A4F6C9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6C9"
FT                   /protein_id="CAL99603.1"
FT                   /translation="MRLDIVRLLGCTSRRAFDVDDSGRVLAGSDESGSVQLAEIAGGEV
FT                   SALTALPGAVSGRYLPGERAVVVQHDTDGDERSQLSLLTLDVPRTGPATMRDLRPLVHD
FT                   SRYVHRLLDVLPGRVVYATNRRNGVDFDVVVRSATSGAEEVVYDRGGMVLEAASSPDGR
FT                   YLAVTVPAEKPLSDQIILVDTMPVTADEEVTELTDADAHARHTGVRWLPDASALVVTTN
FT                   LDRDRTGVARIDPRTGERRWLVTSDEHDLTGWLAPDGSTLLVQANVEGAARLALHDAAT
FT                   GAVRRDVRLPGDGWCTYPLPAPVWSPNSRFAALSYSSTATPGDALLLDSGGEVRALTDS
FT                   AAQLGSARPVPPTAHRVPTPDGEQVPCFVYAPENPPPDVAGSSVLFVHGGPEAQSVQAF
FT                   NPIVQALVDQGHTVLVPNVRGSTGYGKRWYSADDVRRRLSAVDDLAALHDWLPSLGLDP
FT                   SRAALWGGSYGGYMVLAGLAFQPERWAAGVDIVGISSLLTFLENTAAYRRAHREREYGS
FT                   LRDDADFLREASPLTRADAISAPLFVLHGANDPRVPLSEAEQLAQAVRAKGIECELLVY
FT                   ADEGHGLAKRVNRLDAYPRALAFLLRHLRR"
     atgaggctgg acatcgtgcg gttgctcggg tgcacaagcc ggcgggcctt cgacgtcgac        60
     gacagcggcc gggtgctggc cgggtccgac gagtcgggct cggtgcagct cgccgagatc       120
     gccggcggcg aggtcagcgc cctcaccgcg ctgcccgggg cggtcagcgg ccgctacctg       180
     ccgggcgagc gcgcggtggt cgtgcagcac gacaccgacg gcgacgagcg cagccagctc       240
     tccctcctca ccctggacgt gccccggacc gggcccgcga ccatgcgcga cctgcggccg       300
     ctggtccacg actcccgcta cgtgcaccgg ctgctcgacg tgctgcccgg ccgggtcgtc       360
     tacgcgacca accgccgcaa cggcgtggac ttcgacgtcg tggtacgcag cgccacctcc       420
     ggcgcggaag aggtggtcta cgaccgcggc gggatggtgc tggaggcggc gtcctcaccg       480
     gacggccgct acctcgcggt gaccgtgccc gccgagaagc cgctgtcgga ccagatcatc       540
     ctcgtcgaca ccatgccggt caccgccgac gaggaggtca ccgagctcac cgacgcggac       600
     gcgcacgccc ggcacaccgg ggtccgctgg ctgcccgacg cctccgcgct cgtcgtcacc       660
     accaacctcg accgcgaccg gaccggcgtg gcccgcatcg acccgcggac cggcgagcgg       720
     cgctggctgg tgacctccga cgagcacgac ctcaccggct ggctcgcccc ggacggctcg       780
     acgctgctgg tgcaggccaa cgtcgagggc gcagcccggc tcgcgctgca cgatgcggcc       840
     accggtgccg tgcgccggga cgtccggtta cccggcgacg gctggtgcac ctacccgctg       900
     ccggcgccgg tctggtcgcc gaactcccgc ttcgcggcgc tgtcgtacag ctccaccgcg       960
     acccccggag acgcgctgct gctggactcc ggcggcgagg tccgcgccct gaccgactcg      1020
     gccgcccagc tcggttccgc gcgtccggtg ccgccgaccg cccaccgagt gccgacgccg      1080
     gacggcgagc aggtgccctg cttcgtctac gcgccggaga acccgccgcc ggacgtcgcg      1140
     ggctcgtcgg tcctgttcgt ccacggcggg ccggaagccc agtccgtgca ggcgttcaac      1200
     ccgatcgtgc aagcgctggt cgaccagggc cacaccgtgc tggtgcccaa cgtgcgcggc      1260
     tccaccggct acggaaagcg ctggtactcc gccgacgacg tgcgcaggcg gctgtccgct      1320
     gtggacgacc tcgctgccct gcacgactgg ctgccctcgc tcgggctcga cccgtcccgg      1380
     gcggcgctct ggggcggctc ctacggcggc tacatggttc tggccggact ggctttccag      1440
     ccagagcggt gggcggcggg cgtggacatc gtcgggatct cgtcgctgct gacgttcctg      1500
     gagaacaccg ccgcctaccg gcgggcgcac cgcgagcgcg agtacgggtc gctgcgcgac      1560
     gacgccgact tcctgcggga ggcatcgccc ctgacccgag cggacgcgat ctcggcgccg      1620
     ctgttcgtgc tgcacggcgc caacgacccc cgggtcccgc tgtcggaggc cgagcagctc      1680
     gcgcaggccg tgcgggcgaa gggaatcgag tgcgagctgc tggtctacgc cgacgagggc      1740
     cacggccttg ccaagcgggt caaccgcctc gacgcctacc cgcgcgcgct cgccttcctg      1800
     ctgcgccacc tccgccggta g                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page