(data stored in ACNUC1104 zone)

EMBL: AM420293.PE249

AM420293.PE249       Location/Qualifiers
FT   CDS_pept        290359..290709
FT                   /transl_table=11
FT                   /locus_tag="SACE_0254"
FT                   /product="hypothetical protein"
FT                   /function="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99604"
FT                   /db_xref="GOA:A4F6D0"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4F6D0"
FT                   /protein_id="CAL99604.1"
FT                   /translation="MQPGGQPNMQQIMEQAQKMQQQLMTAQQELAEAEVSGSAGGGLVT
FT                   AVVSGSGELKSVAIDPKAVDPDDTDTLSDLVVAAVRDANRAAQELQQEKMGPVTGALGG
FT                   GQGLGGLGLPGL"
     gtgcaaccag gtggccagcc gaacatgcag cagatcatgg aacaggcgca gaagatgcag        60
     cagcagctga tgaccgcgca gcaggagctc gccgaggccg aggtcagcgg cagcgcgggc       120
     ggtggcctgg tgaccgcggt ggtcagcggt tccggtgagc tcaagtcggt cgcgatcgac       180
     ccgaaggcgg tcgaccccga cgacaccgac accctctccg acctggtggt ggcggcggtg       240
     cgcgacgcca accgggccgc ccaggagctg cagcaggaga agatgggccc ggtgaccggc       300
     gcgctcggcg gcgggcaggg gctgggcggg ctcggcctgc cgggactgtg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page