(data stored in ACNUC1104 zone)

EMBL: AM420293.PE25

AM420293.PE25        Location/Qualifiers
FT   CDS_pept        47170..47676
FT                   /transl_table=11
FT                   /locus_tag="SACE_0027"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /function="Biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99380"
FT                   /db_xref="GOA:A4F5Q6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q6"
FT                   /protein_id="CAL99380.1"
FT                   /translation="MTAHITDGTGVTRIAGEAPEHGDSLATLRAEAERLMRAAGRPVRR
FT                   VSLRAGGNAIEVDWETGDEQGGAAAVGTAQPPVEETAGEDRAIRVVAPLVGTFYHAPSP
FT                   GEAPFVEVGDVVEEGQQLGIVEAMKLMNPVTADRPGRVRAVLAPDGELVEFEQVLVELD
FT                   PVEEV"
     atgaccgcgc acatcaccga cggaaccggc gtcacccgga tcgcgggtga ggcacccgaa        60
     cacggcgaca gcctcgccac ccttcgcgcc gaggcggaac ggctgatgcg cgcggcgggc       120
     cggccggtgc gccgggtgag cctgcgcgcc ggtggcaacg cgatcgaggt cgactgggag       180
     accggcgacg agcagggagg tgccgcggcg gtcggtaccg ctcagccgcc ggtcgaggag       240
     accgcggggg aggaccgcgc gatccgcgtc gtcgcgccgc tcgtcggcac cttctaccac       300
     gccccgtcac cgggcgaagc gccgttcgtc gaggtcggtg acgtggtgga ggagggccag       360
     cagctcggca tcgtcgaggc gatgaagctg atgaacccgg tcacggccga tcggcccggg       420
     cgggtccgcg cagtcctggc ccccgacggc gaactggtgg agttcgagca ggtcctggtg       480
     gagctcgacc ccgtcgagga ggtgtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page