(data stored in ACNUC1104 zone)

EMBL: AM420293.PE251

AM420293.PE251       Location/Qualifiers
FT   CDS_pept        291661..292185
FT                   /transl_table=11
FT                   /locus_tag="SACE_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99606"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D2"
FT                   /protein_id="CAL99606.1"
FT                   /translation="MRLVAVDGPSGSGKSVFARGLVAALRADGLRTALVPTDDFATWDE
FT                   PVGWWPRLAEGVLDPLRRGEPGRYQRTEWPGGEPVLGAWVDVEVPDVLVVEGVSSARRA
FT                   VADRLSLAIWVEVGDPALRLERAVARDGEWSRPHLLRWQEFERRWFAEDGAKHRADILR
FT                   QRSSPLSRQRR"
     gtgcggctgg tcgccgtcga cggaccctcc gggtccggca agtcggtgtt cgcccgcggc        60
     ctggtggccg cgctgcgcgc ggacggcctg cgcaccgcgc tggtgccgac cgatgacttc       120
     gccacctggg acgagccggt cgggtggtgg ccgcgcctgg ccgagggcgt tctcgatccg       180
     ttgcggcgcg gcgagcccgg ccgctaccag cgcaccgaat ggcccggcgg ggagccggtc       240
     ctcggtgcgt gggtcgacgt cgaggtgccc gacgtcctgg tggtcgaggg cgtttcgtcc       300
     gcccggcgcg cggtggccga ccggctgtcg ctcgccatct gggtcgaggt cggcgatccc       360
     gctctgcggc tggagcgcgc ggtcgcccgc gacggcgaat ggagtcgtcc gcacctgctc       420
     cgttggcagg agttcgagcg ccgctggttc gccgaggacg gcgcgaagca ccgcgccgac       480
     atcctccgcc aacgatcttc accgttgtcc cgccaacgcc gctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page