(data stored in ACNUC1104 zone)

EMBL: AM420293.PE252

AM420293.PE252       Location/Qualifiers
FT   CDS_pept        292407..294023
FT                   /transl_table=11
FT                   /locus_tag="SACE_0257"
FT                   /product="dipeptide ABC transporter substrate-binding
FT                   protein"
FT                   /function="ABC-type dipeptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99607"
FT                   /db_xref="GOA:A4F6D3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D3"
FT                   /protein_id="CAL99607.1"
FT                   /translation="MAVTLAACATSQRGENAGGEGGTLTFGAAGAPDLFDPFYASDGET
FT                   FRVTRQIMEGLVGFEPGTAEVEPELAKSWESTPDGKTWTFKLNEGVKFHDGTDFNAEAV
FT                   CKNFERWYHQTGAGQNQALSYYWIENFGGFADGQTPSLYSSCDSPDPATAVIHLTRATS
FT                   KFPDLLGLPSFSMQSPAAMEQYQANNVQAQGDSFSYPEYAKAHPTGTGPFKFSGYDEGN
FT                   QTIKLARNDQYWGEKAKIGELIFRIIPDETSRKQELEAGSIDGYDFPNAADLQALRDAG
FT                   HNVLVRDPFNIMYLGFTQKNNPALNDLRVRQAIAYALDRDNLVKANMPEGAEVATQFYP
FT                   DTVEGYAPDVQKYPHDPEKAKQLLAEAGQQNLTVNFYWPTEVTRPYMPDPQGIYNALAE
FT                   DLRAVGITVNPVSKPWNGGYIDDVDNARADIFLLGWTGDYNTPDNYIGTFFGTPTNRFY
FT                   TAGAPWGEQLAAELRAADSEPDEGKRQAMYQQINRKLLAEYLPAVPLSHSPPALVLNER
FT                   VKGLVPSPLTDEEFATVSLSE"
     atggcggtca cgcttgcggc ctgcgccact tcgcagcgag gcgagaacgc cggcggcgaa        60
     ggcggcaccc tgaccttcgg tgctgcgggc gccccggacc tgttcgaccc cttctacgca       120
     tccgacggcg agaccttccg cgtcacccgg cagatcatgg agggcctggt cggcttcgaa       180
     ccgggcaccg ccgaggtcga accggagctg gccaagagct gggagtccac accggacggc       240
     aagacgtgga cgttcaagct caacgagggc gtgaagttcc acgacggcac cgacttcaac       300
     gccgaggccg tctgcaagaa cttcgagcgc tggtaccacc agaccggcgc gggccagaac       360
     caggcgctct cgtactactg gatcgagaac ttcggtgggt tcgccgacgg ccagacgccg       420
     tcgctgtact cctcctgcga ttcgccggac ccggcgaccg cggtgatcca cctgacgcgc       480
     gcgacgtcga agtttccgga cctgctcggt cttccgtcgt tcagcatgca gtcgccggcc       540
     gcgatggagc agtaccaggc caacaacgtc caggcccagg gcgacagctt ctcctacccc       600
     gagtacgcca aggcgcaccc gacgggcacc gggccgttca agttcagcgg ctacgacgag       660
     ggcaaccaga ccatcaagct ggcccgcaac gaccagtact ggggcgagaa ggccaagatc       720
     ggcgagctga tcttccggat catccccgac gagacctcgc gcaagcagga gctggaagcc       780
     ggcagcatcg acggctacga cttccccaac gccgccgacc tgcaggcgct gcgcgacgcc       840
     gggcacaacg tgctggtgcg cgacccgttc aacatcatgt acctgggctt cacccagaag       900
     aacaacccgg cgctgaacga cctgcgggtg cgccaggcca tcgcctacgc gctggaccgc       960
     gacaacctgg tcaaggccaa catgcccgag ggcgccgagg tggccaccca gttctacccg      1020
     gacaccgtcg agggatacgc cccggacgtg cagaagtacc cgcacgaccc ggagaaggcc      1080
     aagcagctgc tcgccgaggc agggcagcag aacctgacgg tcaacttcta ctggccgacc      1140
     gaggtcaccc ggccctacat gccggacccc cagggcatct acaacgcgct ggccgaggac      1200
     ctgcgcgccg tgggcatcac ggtgaacccg gtcagcaagc cgtggaacgg cggctacatc      1260
     gacgacgtcg acaacgcccg cgccgacatc ttcctgctcg gctggaccgg cgactacaac      1320
     acgccggaca actacatcgg cacgttcttc ggcacgccga cgaaccgctt ctacaccgcg      1380
     ggcgcaccgt ggggcgagca gctcgccgcc gagctgcgcg ccgccgacag cgagcccgac      1440
     gagggcaagc ggcaggcgat gtaccagcag atcaaccgca agctgctggc cgagtacctg      1500
     cccgcggtcc cgctgtcgca ctcgccgccc gcgctcgtgc tcaacgagcg ggtgaagggc      1560
     ctggtcccct cgccgctgac ggacgaagag ttcgcgacgg tgagcctctc cgagtga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page