(data stored in ACNUC1104 zone)

EMBL: AM420293.PE253

AM420293.PE253       Location/Qualifiers
FT   CDS_pept        294180..295154
FT                   /transl_table=11
FT                   /locus_tag="SACE_0258"
FT                   /product="oligopeptide/dipeptide ABC transporter, permease
FT                   protein"
FT                   /function="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99608"
FT                   /db_xref="GOA:A4F6D4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D4"
FT                   /protein_id="CAL99608.1"
FT                   /translation="MLVVAVLSVLLFAWLRALPGGPVSALLGDRATPESRAKLEAQLGL
FT                   DQPIFVQYWKFLERAVTGDFGTSTGVQRGAPALEVFLVRFPATLELSILALLLAVAVGI
FT                   PLGYLAARRRGSWLDNLSITWSLVGVAVPVFFLAFLLKFVFAVELGMLPASGRQDTGMD
FT                   ATRVTGFYILDGLLTREWDAAWNAFVHLVLPAIALSTIPFAVIFRITRAAVLDVMDDDY
FT                   VRTARAKGLSAMVIRTRHILHNAMLPVVTTVGLQTGALLAGAVLTERVFNIPGIGQAVA
FT                   VGFQRKDFPVLQVVILSAAMVYVLVNLIVDLSYAMIDPRLRTR"
     gtgctggtcg tcgctgtgct gtccgtcctg ctgttcgcct ggctgcgggc gctgcccggc        60
     ggcccggtgt cggcgctgct gggcgaccgg gcgacgcccg agtcccgcgc gaagctcgag       120
     gcgcagctcg gcctggacca gcccatcttc gtgcagtact ggaagttcct ggagcgcgcc       180
     gtcaccggcg acttcggcac ctccaccggt gtccagcgcg gtgcgcccgc gctggaggtc       240
     ttcctggtgc gcttcccggc gacgctggag ctgtcgatcc tggcgctgct gctggcggtc       300
     gcggtcggca tcccgctcgg ctacctggcg gcccggcgcc gggggagctg gctggacaac       360
     ctgagcatca cgtggtcgct ggtgggcgtc gcggttccgg tgttcttcct ggcgttcctg       420
     ctgaagttcg tcttcgccgt cgagctcggc atgctgcccg cctcgggccg ccaggacacc       480
     gggatggacg cgacgcgggt gaccggcttc tacatcctcg acgggttgct gacccgggag       540
     tgggacgcgg cgtggaacgc cttcgtgcac ctggtcctgc ccgcgatcgc gctgtcgacc       600
     atcccgttcg cggtgatctt ccggatcacc agggccgcgg tgctcgacgt gatggacgac       660
     gactacgtgc gcacggcgcg ggcgaagggc ctgagcgcga tggtgatcag gaccaggcac       720
     atcctgcaca acgcgatgct gccggtggtc accacggtcg gcctgcagac cggcgcgctg       780
     ctggcgggcg cggtgctgac cgagcgggtg ttcaacatcc ccggcatcgg gcaggcggtc       840
     gcggtcggct tccagcgcaa ggacttcccc gtgctgcagg tcgtgatcct gtccgcggcg       900
     atggtgtacg tgctggtcaa cctgatcgtc gacctctcgt acgcgatgat cgacccgcgg       960
     ctgcggacgc ggtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page