(data stored in ACNUC1104 zone)

EMBL: AM420293.PE256

AM420293.PE256       Location/Qualifiers
FT   CDS_pept        297225..298331
FT                   /transl_table=11
FT                   /locus_tag="SACE_0261"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /function="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99611"
FT                   /db_xref="GOA:A4F6D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D7"
FT                   /protein_id="CAL99611.1"
FT                   /translation="MTEQLLVEVDDLAVHFPIKRGVVLDRTVGYVYAVDGVSLRVRKGE
FT                   TYGLVGESGCGKSTLGRALLRLEKPTGGRVVFDGTDLSAMKGERLRRMRRRMQMVFQDP
FT                   LASLDPRQSVESLLVEGIRAHGLDKGRESTAKRLRELLSAVGLPSTSLRKYPHEFSGGQ
FT                   RQRIGIARALAVGPDLLVADEPVSALDVSVQAQVLNLLEDLQDEFGLTYLVIAHDLAVV
FT                   RHIADRIGVMYLGGIVEESESDDLYTEPLHPYTRALLSAVPVPDPVVEDQREQILLSGD
FT                   LPSPAAPPTGCRFHTRCPWKQQTRCDTERPVLREISPGHRVACHYAEEIRSGAIAKHDV
FT                   EAEAVAPDDFGGIAVGSTSPASTTEALG"
     atgaccgagc agctcctggt ggaggtcgac gacctcgcgg tgcacttccc gatcaagcgc        60
     ggggtggtgc tcgaccgcac ggtcggctac gtctacgccg tcgacggggt gtcgctgcgc       120
     gtccgcaagg gcgagacata cggcctggtc ggcgagtcgg gctgcggcaa gtcgacgctc       180
     gggcgcgcgc tgctgcgcct ggagaagccg accggcggcc gggtggtctt cgacggcacc       240
     gacctgtcgg cgatgaaggg cgaacggctg cgccgtatgc gccgtcgcat gcagatggtg       300
     ttccaggacc cgctcgcctc gctcgacccg cggcagtcgg tggagtcgct gctggtcgag       360
     gggatacgcg cgcacggtct ggacaagggc cgcgagtcca cggcgaagcg cctgcgcgag       420
     ctgctcagcg cggtggggct gccgtcgacg tcgctgcgca agtacccgca cgagttctcc       480
     ggcgggcagc gccagcgcat cggcatcgca cgcgcgctgg cggtcggccc cgacctgctg       540
     gtcgccgacg agccggtgtc ggcgctcgac gtctcggtgc aggcgcaggt gctcaacctg       600
     ctggaggacc tgcaggacga gttcggcctg acctacctgg tgatcgcgca cgacctcgcg       660
     gtcgtccgcc acatcgccga ccggatcggg gtgatgtacc tgggcgggat cgtggaggag       720
     tcggagtccg acgacctcta caccgagccc ctgcacccct acacgcgcgc gctgctgtcg       780
     gcggtcccgg tgccggaccc ggtcgtggag gaccagcggg agcagatcct gctctccggt       840
     gacctgccct cgccggccgc gccgccgacg gggtgccgct tccacacccg ctgcccgtgg       900
     aagcagcaga ctcgctgcga caccgaacgc ccggtgctgc gcgagatctc ccccggtcac       960
     cgggtggcct gccactacgc cgaggagatc cgcagcggcg ctatcgccaa gcacgacgtc      1020
     gaggccgagg cggtcgcgcc ggacgacttc ggtggcatcg ccgtcggctc cacctcgccg      1080
     gcctcgacca ccgaggcgct cggctga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page