(data stored in ACNUC1104 zone)

EMBL: AM420293.PE258

AM420293.PE258       Location/Qualifiers
FT   CDS_pept        complement(298598..299494)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0263"
FT                   /product="probable amino acid metabolite transport protein"
FT                   /function="7 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99613"
FT                   /db_xref="GOA:A4F6D9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6D9"
FT                   /protein_id="CAL99613.1"
FT                   /translation="MALFVVLLWGVNFIAIDFGLQHFPPLFFGGLRFALIALPTILFVP
FT                   RPKVRWQWLVGYGLGFGTLQFAFLFVAIEVGMPTGLASLVLQASAPFTVILGALLLRER
FT                   LNALQGLGIAIAVLGMVAIGWNRAQDAALLPVVLTLLGALGWAFGNLCNRKANPQNPLH
FT                   LALWMSVVPPLPMFALSAFVEGPVVGWQAVWTSFTTQTGLYALCGLAYIIVFATVIGSG
FT                   VWTALMGRNPASSVAPFTLLVPVVGFTSAWLVLNEQPDPFELVAGAVVVGGVLLGSIRR
FT                   GKPVELPEPEPVLTPAR"
     ttggccctgt tcgtcgtcct gctgtggggc gtcaacttca tcgctatcga cttcggcctt        60
     cagcacttcc cgccgctgtt cttcggcgga ctgcgcttcg cgctgatcgc cctgcccacg       120
     atcctgttcg tgccgcggcc gaaggtgcgg tggcagtggc tggtcggcta cggcctcggc       180
     ttcgggacgc tgcagttcgc gttcctcttc gtcgcgatcg aggtcgggat gccgacggga       240
     ctggcgtcgc tggtgctcca ggcttccgcg ccgttcaccg tgatcctcgg cgcgctgctg       300
     ctgcgagagc ggctgaacgc gttgcagggt ctgggaatcg cgatcgcggt gctcggcatg       360
     gtcgcgatcg gctggaaccg ggcgcaggac gccgcgctgc tgccggtcgt gctgaccctg       420
     ctcggcgcgc tgggctgggc gttcggaaac ctgtgcaacc gcaaggcgaa cccgcagaac       480
     ccgctgcacc tggcgctgtg gatgtcggtc gtgccgccgc tgccgatgtt cgcgctgtcg       540
     gcgttcgtcg agggcccggt ggtgggctgg caggcggtct ggacgtcgtt caccacgcag       600
     accggcctct acgcgctgtg cgggctcgcc tacatcatcg tcttcgccac ggtgatcggc       660
     tcgggggtct ggacggcgct catgggtcgc aacccggcca gctccgtcgc gccgttcacc       720
     ctgctggtgc cggtcgtcgg gttcacctcg gcatggctgg tgctgaacga gcagccagac       780
     ccgttcgagc tggtcgcggg cgccgtcgtg gtgggcgggg tgctgctcgg cagcatccgg       840
     cgcggcaagc ccgtcgagct cccggaaccg gaaccggtgc tcacgccggc gaggtga          897
//

If you have problems or comments...

PBIL Back to PBIL home page