(data stored in ACNUC1104 zone)

EMBL: AM420293.PE262

AM420293.PE262       Location/Qualifiers
FT   CDS_pept        complement(302802..302996)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99617"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E3"
FT                   /protein_id="CAL99617.1"
FT                   /translation="MIDTPTGWRKSSRSGQKSACVEVGRAADGAAVRDTKDRAAGYFTT
FT                   TAPQWSAFITGIKAGRFDR"
     atgatcgaca cgcccacggg gtggcgcaag tccagccgat ccggccagaa gtccgcgtgc        60
     gtcgaggtcg gccgggcggc tgacggcgcc gccgtccgcg acaccaagga ccgggccgcc       120
     gggtacttca ccaccaccgc cccgcagtgg tcggccttca tcaccggcat caaggcgggg       180
     cgcttcgacc gctga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page