(data stored in SCRATCH zone)

EMBL: AM420293.PE264

AM420293.PE264       Location/Qualifiers
FT   CDS_pept        303960..304256
FT                   /transl_table=11
FT                   /locus_tag="SACE_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99619"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6E5"
FT                   /protein_id="CAL99619.1"
FT                   /translation="MFADEGSARCGTVLPTAYRSDVVFWIVPVGEDVRHGTTTRPGALP
FT                   AGSEVLVLCARRFKLPTSTPWPDVPKTKSVTRQCEDCVAEYERLGRPATVWDF"
     atgttcgccg atgaaggcag cgcccggtgc ggcaccgtcc tcccgaccgc gtaccgctcc        60
     gacgtcgtgt tctggatcgt ccccgtgggc gaggacgtcc gtcacggcac gacgacccgg       120
     ccgggtgcgc tgcccgccgg gtccgaggtt ctcgtgctgt gcgctcgccg cttcaagctg       180
     ccgacatcga cgccgtggcc ggacgtgccg aagacgaaat ccgtcacgcg gcagtgcgag       240
     gactgcgtgg ccgagtacga gcggttggga cgccccgcca ccgtctggga cttctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page