(data stored in SCRATCH zone)

EMBL: AM420293.PE269

AM420293.PE269       Location/Qualifiers
FT   CDS_pept        309847..310128
FT                   /transl_table=11
FT                   /locus_tag="SACE_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99624"
FT                   /db_xref="GOA:A4F6F0"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F0"
FT                   /protein_id="CAL99624.1"
FT                   /translation="MAAKRGRSGVATLINGAGFVIAAMLVLHIVFVLTGFPTENGLAGS
FT                   VRQAAEPLALFFPGMVDAGDEVLQVMADFGLAAVFWVLVTGLLARVFG"
     atggctgcca agagaggtcg gtccggtgtc gcgacgctga tcaacggcgc cggtttcgtg        60
     atcgccgcga tgctggtgct gcacatcgtc ttcgtcctga cggggttccc gacggagaac       120
     gggctcgccg gttcggtgcg gcaggccgcg gagccgctcg cgctgttctt cccgggcatg       180
     gtcgacgcgg gcgacgaggt cctgcaggtg atggccgact tcgggctcgc ggcggtgttc       240
     tgggtgctgg tcaccggcct cctggcccgc gtgttcggct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page