(data stored in ACNUC1104 zone)

EMBL: AM420293.PE275

AM420293.PE275       Location/Qualifiers
FT   CDS_pept        complement(313597..314817)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0281"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99630"
FT                   /db_xref="GOA:A4F6F6"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6F6"
FT                   /protein_id="CAL99630.1"
FT                   /translation="MDPQRCNTAETVRNQQKRPGDHRLAAVREALREHRRGLLLVAPGV
FT                   VYLAIRFFGLLVLAWLSAANDESLSDNLGAWDGEWYLEIAEHDYGGVDPGMVDGFGNRY
FT                   PETPLAFFPGYPLLVRLFGLLPGVSALGAAITVSLLCGVVAAYGLARLGKRIGGSEGTG
FT                   LLLVVLFAAAPMSVVLSMAYSEALFCALSIWALIGVVERKWLLAGLCCAAAGLVRPTAA
FT                   ALIAVVGLAALIAIVRRRELWRPLLAMLLAPIGMLAYVGWVGLQTGKLGGYFELQQRGW
FT                   SSAFDGGVRTTEFVVETLTADKSVLETFTAWIVLAALVLFVLCLRYRMPWPLVLFAAAV
FT                   LVLDLGSDGLMYSKVRLMLPAFPLLVPVAIGLANRRTTTAVCTAVLLVCFGSWFGAYSL
FT                   TAWPYAM"
     ttggacccgc agcggtgcaa caccgcggag acagtccgca accagcagaa acgtcccggt        60
     gaccaccggc tggccgcggt ccgggaggcg ctgcgcgaac accgccgcgg actgctcctg       120
     gtggccccgg gtgtggttta cctcgcaatc cgtttcttcg gcctgctggt gctggcgtgg       180
     ctgtcggcgg ccaatgacga atctctctcc gacaacctcg gcgcctggga cggcgagtgg       240
     tacctggaga tcgccgagca cgactacggc ggggtcgacc cgggcatggt cgacgggttc       300
     ggcaaccgct acccggagac accgctggcg ttcttccccg gctacccgct gctggtgcgg       360
     ctgttcggcc tgctcccggg cgtgagcgcg ctcggcgcgg cgatcacggt gagcctgctg       420
     tgcggcgtgg tggccgccta cggcctggcc cggctcggga agcggatcgg cggttcggag       480
     gggaccgggc tgctgctggt ggtgctgttc gcggcggcgc cgatgtcggt cgtgctgtcc       540
     atggcgtact cggaggcgct gttctgcgcg ctgtccatct gggcgctgat cggtgtcgtc       600
     gagcgcaagt ggctgctggc cggcctgtgc tgcgcggcgg ccgggctggt gcggccgacc       660
     gcggccgcgc tgatcgcggt ggtcgggctg gcggcgctga tcgccatcgt ccggcggcgg       720
     gagctgtggc ggccgctgct ggcgatgctg ctggcgccga tcggcatgct cgcctacgtg       780
     ggctgggtcg gcttgcagac cggcaagctc ggcggctact tcgagctcca gcagcgcggc       840
     tggtcgtcgg ccttcgacgg cggcgtgcgg accacggagt tcgtcgtcga gacgctgacc       900
     gccgacaagt cggtgctgga gaccttcacc gcctggatag tgctggccgc gctggtgctg       960
     ttcgtgctgt gcctgcgcta ccggatgccg tggccgctgg tgctgttcgc cgcggcggtg      1020
     ctggtgctcg acctcggctc ggacgggctg atgtactcca aggtccggct gatgctgccg      1080
     gcgttcccgc tgctggtacc ggtggccatc ggactggcca accggcggac gacgacggcg      1140
     gtctgcacgg cggtgctgct ggtctgcttc gggtcctggt tcggggccta ctctctgacc      1200
     gcatggccct acgcgatgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page