(data stored in SCRATCH zone)

EMBL: AM420293.PE28

AM420293.PE28        Location/Qualifiers
FT   CDS_pept        complement(49905..50441)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0030"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99383"
FT                   /db_xref="GOA:A4F5Q9"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5Q9"
FT                   /protein_id="CAL99383.1"
FT                   /translation="MFERFTRTARDTVVRAVEEAKRAEAAEVTAEHLALALLATPCGAL
FT                   LAEHGVRREDIASAYETARRRAGLSESDASALRALAIEVDHVVGSVEGAHGTGAMVPRG
FT                   RRRRFAPRGHVPVAADTKEVLRRCLREAVDMGDRQLDDRHLLLGLVTTCGVAADLLDEH
FT                   GIDYASLRARRRKAS"
     atgttcgagc gattcacgcg caccgcacgc gacaccgtcg tccgggccgt cgaggaggcc        60
     aagcgggccg aagccgccga ggtcaccgcg gagcacctgg cgctggcact gctggcgacc       120
     ccgtgcggag ccctgctggc cgagcacggc gtgcggcgcg aggacatcgc gtcggcctac       180
     gagacggccc gtcgccgcgc cgggctctcc gagtccgacg cctcggctct gcgcgcgctg       240
     gccatcgagg tggaccacgt cgtcggcagc gtcgaggggg cccacggcac cggagcgatg       300
     gtgccgcgcg ggcgccgccg ccgcttcgcg ccgcgcgggc acgtccccgt cgccgccgac       360
     accaaggagg tgctgcggcg ctgcctgcgg gaggcggtgg acatgggcga ccggcagctc       420
     gacgaccgcc acctgctgct gggtctggtc accacctgcg gcgtcgcggc cgacctgctg       480
     gacgagcacg ggatcgacta cgcctccctg cgggctcgcc ggcgcaaagc gagctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page