(data stored in ACNUC1104 zone)

EMBL: AM420293.PE286

AM420293.PE286       Location/Qualifiers
FT   CDS_pept        complement(324327..326795)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0292"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99641"
FT                   /db_xref="GOA:A4F6G7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6G7"
FT                   /protein_id="CAL99641.1"
FT                   /translation="MNHPTNPQAASAAGVHAAGLRAAIAAEPAAPVVAGIQGAGGYGKS
FT                   ALLSQLAGIYQAAGIPVSSSPDASRDGAHLVDDAHLLDETSLYALRAIAEKPGARVVVA
FT                   YRPGPRSHALSELIATLGAPVLLTGLGRDEVARGLPGPASREWIDWLIEQTGGVPRFVG
FT                   RVTGTIDPSQLGDRTLPRLALEQFRHDFDQLGEHARACVTAMSVGAAPHPEVLASVLEL
FT                   DPGHVAGALASVRSGGLVDDHDMPWPIVRAAAQLLTPLEVRLGIVRRLVDAQLAHGGPV
FT                   LPLVRPLLGARVALLPEATLSAAFEKGGDEALAEAPELAGRLFDAAVSAGVPESRVAAR
FT                   RARAAAAAGRLDEALRLADRVIVDPAVPDRALGVQVAASVLAHRGLLAQSADLCAWSVD
FT                   NLRWSGDTAYAAVGLVGTGRLREADELLSSRRESGPPTSLSGAAAKLAGGVRESVTGAA
FT                   TSALSTLVRAAALADPVGPGVMLPDSPAAIAATVALHCGELDVAESSLAKAVESGSGGP
FT                   LLEVRHRLLAAWVPLMRGDTVTARQALGSVPSELAARDRLLATALHAGIAGRDNDMTAL
FT                   TAIRGQARQAAAEHSPDLFCLLPLGELVVATARLHDQDWLTPYLHEAQALLSALGNPPL
FT                   WTSMLTWKCLQAAVVVEDMDSAARHAADLGETAHHNPMSAAMAEAARMWLRVLDGQVDQ
FT                   DEAERAARGLHAAGLTWDGARLAGQAAIRTTDRKAMLSLLECARALQGKQPRPRAMSAN
FT                   AGEGELLSDREREVAQLVLAGLTYKQVGKRLFISAKTVEHHIGRIRQRLGCQSREELLD
FT                   RLRELVGSEA"
     ttgaaccacc cgacgaaccc gcaggccgcg tcggcggccg gggtgcacgc agcagggctg        60
     cgggctgcca tcgcggccga gcccgccgct ccggtggtcg ctgggatcca gggcgccggc       120
     ggatacggca agagcgcgct gctgtcccag ctcgccggga tctaccaggc cgcgggcatc       180
     cccgtgtcgt cgtcaccgga cgcgtcgcgg gacggggcgc acctcgtcga cgacgcgcac       240
     ctgctcgacg agacctcgct gtacgcgctg cgcgcgatcg ccgagaagcc cggagcccgg       300
     gtcgtcgtcg cctaccgccc gggaccgcgc tcgcacgcgc tctccgagct gatcgccacc       360
     ctcggggcgc cggtgctgct gaccggcctc ggccgcgacg aggtcgcgcg cgggctcccc       420
     gggccggcgt cgcgggagtg gatcgactgg ctgatcgagc agaccggcgg cgtgccgcgg       480
     ttcgtcggac gcgtcaccgg cacgatcgac ccctcgcagc tcggggacag gacgctgccc       540
     cggctcgcgc tggagcagtt ccgccacgac ttcgaccagc tcggcgagca cgcgcgggcg       600
     tgcgtgacgg cgatgtcggt cggcgccgcc ccgcacccgg aggtgctcgc ctcggtcctc       660
     gagctcgacc cgggccacgt cgcgggagcg ctggcgtcgg tgcgctcggg cggcctggtg       720
     gacgaccacg acatgccgtg gccgatcgtg cgggccgccg cccagctgct gaccccgctg       780
     gaggtgcggc tcggcatcgt gcggcggctg gtcgacgcgc agctcgcgca cggcggacca       840
     gtgctgccgc tggtccgccc gctgctcggc gcccgggtgg cgctgctgcc cgaggcgacg       900
     ctctcggccg ccttcgagaa gggcggcgac gaggcgctgg ccgaggctcc cgagctggcg       960
     ggccgcctgt tcgacgcggc ggtctcggcg ggcgtcccgg agtcgcgggt cgcggcccgc      1020
     cgcgcccggg ccgccgccgc cgcggggcgg ctggacgagg cgctgcggct ggccgaccgg      1080
     gtgatcgtcg accccgccgt ccccgaccgc gcactgggcg tgcaggtcgc ggcgagcgtg      1140
     ctggcccacc gcgggctgct cgcgcagtcc gccgacctgt gcgcgtggtc cgtcgacaac      1200
     ctgcgctggt ccggcgacac cgcctacgcc gcggtcggcc tggtcggcac cggacggctg      1260
     cgcgaagccg acgagctgct gagctcgcgg cgcgagtccg gccctcccac ctcgctctcc      1320
     ggcgcggcgg cgaaactcgc cggcggcgtt cgcgagtcgg tcaccggtgc ggcgaccagc      1380
     gcgctttcca cgctggtcag agccgccgcg ctggccgacc cggtcgggcc gggggtgatg      1440
     ctgcccgaca gcccggcggc catcgccgcc accgtcgcgc tgcactgcgg cgagctcgac      1500
     gtcgccgagt cgtcgctggc caaggccgtc gagtcgggca gcggcggacc gctgctggag      1560
     gtgcggcacc ggctgctcgc cgcgtgggtg ccgttgatgc gcggcgacac ggtgaccgcg      1620
     cggcaggcgc tgggctcggt gccttccgag ctcgccgccc gcgaccggct gctcgccacc      1680
     gccctgcacg ccgggatcgc cgggcgcgac aacgacatga ccgctctcac tgcgatccgc      1740
     ggccaggcgc ggcaggccgc cgccgagcac tctccggatc tgttctgcct gctgccgctg      1800
     ggcgaactcg tggtcgcgac cgcccgcctg cacgaccagg actggctgac cccgtacctg      1860
     cacgaggcac aggcgctgct gagcgcgctc ggcaacccgc cgctgtggac gtcgatgctg      1920
     acctggaagt gcctgcaggc ggcggtggtc gtggaggaca tggactccgc cgcccggcac      1980
     gccgccgacc tgggcgagac cgcccaccac aacccgatgt cggcggccat ggccgaggcc      2040
     gcgcggatgt ggctgcgcgt gctggacggg caggtcgacc aggacgaggc cgaacgcgcc      2100
     gcccgcggcc tgcacgcggc gggcctgacc tgggacgggg cccggctcgc cggtcaggcc      2160
     gcgatccgca ccaccgaccg caaggccatg ctctcgctgc tggagtgcgc ccgcgcgctg      2220
     cagggcaagc agccccggcc gcgggcgatg tcggccaacg cgggcgaggg cgagctgctc      2280
     agcgaccgcg aacgcgaggt cgcgcagctc gtgctggccg ggctcaccta caagcaggtg      2340
     ggcaagcggc tgttcatctc ggccaagacc gtcgagcacc acatcggccg catccgccag      2400
     cgcctcggct gccagagccg ggaggagctg ctcgaccggc tccgggagct ggtcggctcg      2460
     gaggcgtag                                                              2469
//

If you have problems or comments...

PBIL Back to PBIL home page