(data stored in SCRATCH zone)

EMBL: AM420293.PE290

AM420293.PE290       Location/Qualifiers
FT   CDS_pept        332142..333608
FT                   /transl_table=11
FT                   /locus_tag="SACE_0296"
FT                   /product="isoniazid inductible gene protein IniC"
FT                   /function="predicted GTPases (dynamin-related)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99645"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H1"
FT                   /protein_id="CAL99645.1"
FT                   /translation="MSERLLEHARALMVRAMTFYRDDTRTSTWLRGRMERLDQPLRIAV
FT                   SGRVKSGKSTLINALVGEELAPTDAEERTQVSTFYQYGPEPKVLVHTPSGAVQNVPVPS
FT                   LDTGTIRDLQRWRPDEVARLVIESPSPGLQAITLIETPGVASSAVQETGRSALAQILSE
FT                   ADAVLYLTRHPHQTDLQFLQSVHELQIARYAPINTIIAFSRADETGSGGVDALDAAERI
FT                   AQRYRDDPTVRSFSQHVIPVVGLLGQAASTMTAEEFASFVGLARLSQSDLEALLLSADR
FT                   FANSTVPESVPAAVRAKLLERFGRYGIARAMTCLRDGSVTDLKGLRTALLEDSRLNDLQ
FT                   EAVHLQFVERQDALRARSILLAVDMVLRANPRPGVQRLLGEFEHLMVNAAHEWDELRLL
FT                   SSLASGQVRFPRSLQSEAHRMLGAYGHDARSRLGGDDNAMEADLADEAAATLARWREQA
FT                   VNPLHDRAHREAVQTVVRSCERLIASQMRG"
     atgagcgaac gactgctcga gcacgcccgc gcactcatgg tgcgcgcgat gaccttctac        60
     cgcgacgaca cgcggacgtc cacctggctg cgcggccgga tggagcggct cgaccagccg       120
     ctgcgcatcg ccgtcagcgg ccgcgtcaag tccggcaagt cgacgctgat caacgcactg       180
     gtcggggagg agctggcgcc caccgacgcc gaggagcgga cccaggtcag caccttctac       240
     cagtacggac ccgagccgaa ggtgctcgtg cacaccccga gcggcgccgt gcagaacgtc       300
     ccggtgccgt cgctggacac cggcaccatc cgcgacctgc agcggtggcg gcccgacgag       360
     gtggcgcggc tggtgatcga gtcgccgtcg ccgggtttgc aggcgatcac gctgatcgag       420
     acgcctggcg tggcgtcgtc ggcggtgcag gagaccggcc gctccgcgct ggcgcagatc       480
     ctgtccgaag ccgacgcggt gctgtacctg accaggcatc cgcaccagac ggacctgcag       540
     ttcctgcagt cggtgcacga gctgcagatc gcccgctacg cgccgatcaa cacgatcatc       600
     gcgttctccc gcgccgacga gaccggtagc ggcggtgtcg acgcgctgga cgccgcggag       660
     cgcatcgcgc agcgctaccg cgacgacccg accgtgcggt ccttctcgca gcacgtgatc       720
     cccgtcgtgg ggctcctcgg gcaggcggcg tcgacgatga cggcggagga gttcgcctcg       780
     ttcgtcggcc tcgcccggct gtcgcagtcc gacctggagg cgctgctgct gtcggccgac       840
     cggttcgcca acagcaccgt gcccgagtcg gtcccggcgg cggtgcgggc gaagctgctg       900
     gagcgcttcg gccgctacgg catcgcccgc gcgatgacgt gcctgcgcga cggcagcgtc       960
     accgacctca aggggctgcg cacggcgctg ctggaggaca gcaggctcaa cgacctgcag      1020
     gaggcggtgc acctgcagtt cgtggaacgc caggacgccc tgcgggcgcg ctccatcctg      1080
     ctggccgtcg acatggtgct gcgcgcgaac ccgcgccccg gcgtccagcg gctgctcggc      1140
     gagttcgaac acctgatggt caacgccgcg cacgagtggg acgaactgcg gttgctgtcc      1200
     tcgctcgcgt cggggcaggt gcgtttcccg cgttcgctgc agtccgaagc ccaccgcatg      1260
     ctcggcgcct acggccacga cgcgcgcagc agactgggcg gcgacgataa cgccatggag      1320
     gccgacctcg ccgacgaagc ggcggcaacc ctcgcgcgct ggcgcgaaca ggcggtgaac      1380
     cccctgcacg accgcgcgca ccgcgaagcg gtgcagacgg tcgtccgcag ctgcgaacgg      1440
     ctcatcgcat cgcagatgcg aggctga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page