(data stored in SCRATCH zone)

EMBL: AM420293.PE292

AM420293.PE292       Location/Qualifiers
FT   CDS_pept        complement(335026..335553)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99647"
FT                   /db_xref="GOA:A4F6H3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6H3"
FT                   /protein_id="CAL99647.1"
FT                   /translation="MRQRLLTAAAELIPERGWTAVSTRVLAERAGVTPSVVHYHFPSLP
FT                   ALLNEAVVGLMRQMLADVDAFLSAAATPADAVDAMLESVDRYTGADPMSLLFVEACLAA
FT                   TRDEQLRGEIGAVVEEFRQRVGRWLGEHGVSAPAETAAALIAVVDGLLLHRGLGVGPDT
FT                   GSAARVLRRLVA"
     gtgcggcagc gactgctgac cgcagcggcc gagctcatcc ccgaacgcgg ttggaccgcg        60
     gtgagcacga gagtcctggc cgaacgcgcc ggggtgacgc cgagcgtggt ccactaccac       120
     ttcccgtccc tgcctgcgct gctgaacgag gccgtggtcg gcctcatgcg ccagatgctc       180
     gccgacgtgg acgccttcct gagcgcggcg gccacccctg ccgacgcggt cgacgcgatg       240
     ctcgagtcgg tcgaccgcta cacgggggca gacccgatgt cactgctgtt cgtcgaggca       300
     tgtctggcgg ccacccggga cgagcaactc cgcggggaga tcggcgccgt cgtcgaggag       360
     ttccgtcagc gcgtcggccg gtggctgggc gagcacggtg tctccgcccc cgccgagacc       420
     gccgctgccc tgatagccgt cgtcgacggg ctgctgctgc atcgaggact cggcgtgggt       480
     ccggacaccg gttcggccgc gagggttctg cgccggctcg tcgcctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page