(data stored in ACNUC1104 zone)

EMBL: AM420293.PE30

AM420293.PE30        Location/Qualifiers
FT   CDS_pept        complement(50707..51207)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99385"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R1"
FT                   /protein_id="CAL99385.1"
FT                   /translation="MSEQIELSFDIEATTEVDASPDEVYRVVSDITRMGEWSPECTGGE
FT                   WLRGQPGAAGSRFHGHNRAGGETWTTECEVVAAVPGREFAWAVLTYARSPEVSVWSFAI
FT                   EPDGDGCVLTQRYRMQEPPARFASFMRGMDADQAAALGAKRRAMLEDAMSRTVAGIKAA
FT                   VED"
     atgagtgagc agatcgagct gtccttcgac atcgaggcca ccacggaggt cgacgcgtcc        60
     cccgatgagg tctaccgggt cgtcagcgac atcactcgca tgggcgagtg gagcccggag       120
     tgcaccggcg gcgagtggct gcggggccag cccggcgcgg ccgggtcccg gttccacggg       180
     cacaaccggg ccggcgggga gacgtggacc accgagtgcg aggtcgtggc cgcggtcccg       240
     ggccgggagt tcgcgtgggc ggtgctgacc tacgccagga gccccgaggt gtcggtctgg       300
     tcgttcgcga tcgagccgga cggcgacggc tgcgtgctca cccagcgcta ccgcatgcag       360
     gagccgcctg cgaggttcgc gagcttcatg cgcggcatgg acgccgatca ggccgcggcc       420
     ctgggggcca agcggcgggc gatgctcgag gacgccatgt ccaggacggt cgccgggatc       480
     aaggctgccg tggaggactg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page