(data stored in ACNUC1104 zone)

EMBL: AM420293.PE302

AM420293.PE302       Location/Qualifiers
FT   CDS_pept        343728..344255
FT                   /transl_table=11
FT                   /locus_tag="SACE_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99657"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I3"
FT                   /protein_id="CAL99657.1"
FT                   /translation="MTRKVADCRNYPSEMNCTLTISGEEDEVVRAAAEHAISVHGHDDT
FT                   PELRDDIRRLLEDEAPAAAAAGTGAGAPAGDGMHFVQLIEFRTTKRDEVNQLIDEWENA
FT                   TGGKRTASRAVLTADHEQPNSYYEFVEFPSYDEAMRNSALPETEALSRRMRELCDGEPT
FT                   FHNLDVVRAEKL"
     atgaccagga aagtggccga ctgccgcaac tacccgagcg agatgaactg cacgctgacc        60
     atcagcggtg aggaggacga ggtcgtgcgg gccgccgcgg agcacgcgat ctcggtgcac       120
     ggccacgacg acacgcccga gctgcgcgac gacatccgcc gcctcctcga ggacgaggcc       180
     ccggccgcgg ccgcggcggg gaccggagcc ggcgccccgg ccggggacgg gatgcacttc       240
     gtgcagctca tcgagttccg caccaccaag cgggacgagg tgaaccagct gatcgacgag       300
     tgggagaacg cgaccggcgg caagcggacg gcgagccgcg ccgtgctcac cgccgaccac       360
     gaacagccca acagctacta cgaattcgtc gagttcccgt cctacgacga ggcgatgcgc       420
     aactccgcgc taccggaaac cgaggcgctc tcccgcagga tgcgggagct gtgcgacggc       480
     gaaccgacgt tccacaacct cgacgtcgtc cgggcggaga agttgtga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page