(data stored in ACNUC1104 zone)

EMBL: AM420293.PE307

AM420293.PE307       Location/Qualifiers
FT   CDS_pept        complement(349209..349910)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0313"
FT                   /product="FAD-binding 9, siderophore-interacting domain
FT                   protein"
FT                   /function="Siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99662"
FT                   /db_xref="GOA:A4F6I8"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6I8"
FT                   /protein_id="CAL99662.1"
FT                   /translation="MVRVTLGGEELADFVSSGSDQRIKLCLPQPGQPTPLGRDRAEVFA
FT                   LPREQQPKQRTYTVRWFSAQRLELAIDFVVHDHDGPGSTWASRVRPGEQIVAVGPSPSY
FT                   EPNPEADRLVLAGDETALPAMAAILEELPAEAKVRVFAEVADAAERQDIASAADVEWTW
FT                   LHRDGVPAGESDLLVEAVRSADLGPVPYVWVGAEADAVQALREHCQRTLGLDRRRVYAL
FT                   AYWRRGGAATS"
     atggtgcgcg tcaccctcgg cggcgaggag ctggccgact tcgtcagcag cggcagcgac        60
     cagcgcatca agctctgcct gccccagccg gggcagccga caccgctggg acgcgaccgc       120
     gccgaggtct tcgcgctgcc cagggagcag cagcccaagc agcgcaccta caccgtgcgc       180
     tggttcagcg cgcagcggct ggagctcgcg atcgacttcg tcgtgcacga ccacgacggc       240
     cccggcagca cgtgggcgtc gcgggtgcgg ccgggcgagc agatcgtggc ggtcgggccc       300
     agcccgtcct acgagccgaa cccggaggcc gaccggctgg tgctcgccgg ggacgagacg       360
     gcgctgcccg ccatggccgc gatcctggag gagctgcccg cggaggcgaa ggtccgggtg       420
     ttcgccgagg tggccgacgc cgctgagcgc caggacatcg cctcggccgc cgacgtggag       480
     tggacctggc tgcaccgcga cggggtcccg gcgggcgaga gcgacctgct cgtggaggcg       540
     gtccgctccg ccgacctcgg cccggtgccg tacgtgtggg tcggtgcgga agccgacgcg       600
     gtgcaggccc tgcgcgagca ctgccagcgc accctcggcc tggaccgccg tcgggtgtac       660
     gccctggcct actggcgccg cggcggcgcc gcgacctcgt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page