(data stored in ACNUC1104 zone)

EMBL: AM420293.PE312

AM420293.PE312       Location/Qualifiers
FT   CDS_pept        complement(355446..355697)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99667"
FT                   /db_xref="GOA:A4F6J3"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6J3"
FT                   /protein_id="CAL99667.1"
FT                   /translation="METWRIVATALITAVGGFMVLGIMSTVRARRDRAPGEVGRVALHG
FT                   GLVVVVLAALAATVLPPAVCWGLVAAGVLITVGVMITG"
     gtggagacgt ggcggatcgt ggcgacggcg ctgatcacgg cggtcggcgg cttcatggtc        60
     ctcgggatca tgagcaccgt ccgggcccgg cgcgaccgcg cccccggcga ggtcggcagg       120
     gtggccctgc acggcggcct ggtggtcgtg gtcctcgcgg cgctggccgc gacggtgctg       180
     ccgcccgcgg tgtgctgggg tctggtcgcc gcgggggtgc tgatcacggt gggcgtgatg       240
     atcaccggct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page