(data stored in ACNUC1104 zone)

EMBL: AM420293.PE319

AM420293.PE319       Location/Qualifiers
FT   CDS_pept        360500..361327
FT                   /transl_table=11
FT                   /locus_tag="SACE_0325"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /function="Zn-dependent hydrolases, including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99674"
FT                   /db_xref="GOA:A4F6K0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K0"
FT                   /protein_id="CAL99674.1"
FT                   /translation="MEHPAYGAVRPVTAYASVLLARNPDVMTLDGTNTWLVGSPDSADR
FT                   IVIDPGPADRDHLALAAERPVSVVLLTHHHPDHTAGARDFAGLTGAPVRALDPALCAGA
FT                   EPLTDGETVEASGVRLRVLATPGHTADSVCFTVDDPAEPAVFTGDTVLGKGTTVVAHPD
FT                   GHLGSYLESLRLLGDLPEGTRVLPGHGPELPDIRAVSRAYLAHRGQRLGQIRTVLREHG
FT                   PDITARGVVEIVYADVDPAVWPAAEWSVQAQLTYLRELEAPDGASSGPQGPSA"
     atggagcatc ccgcatacgg cgcggtccgt ccggtgaccg cgtacgcgtc agtgctgctg        60
     gcgcgcaacc cggacgtgat gaccctcgac ggcaccaaca cctggctggt cgggtcgccg       120
     gactcggcgg accgcatcgt catcgacccc ggcccggccg accgcgacca cctcgccctg       180
     gccgccgagc gcccggtgtc ggtggtcctg ctgacccacc accacccgga ccacaccgcg       240
     ggcgcccggg acttcgcggg gctgaccggc gccccggtcc gggcgctgga cccggcgctg       300
     tgcgccggcg ccgaaccgct caccgacggg gagacggtcg aagcctccgg cgtgcggctg       360
     cgcgtcctgg ccacgccggg gcacaccgcc gactcggtgt gcttcaccgt cgacgacccc       420
     gccgaaccgg cggtgttcac cggggacacc gtgctgggca agggcacgac ggtcgtggcg       480
     caccccgacg gtcacctcgg ctcgtacctg gagtcgctac gcctgctcgg cgacctgccg       540
     gagggcacca gggtgctgcc aggccacggc cccgagctgc ccgacatcag ggcggtcagc       600
     cgggcctacc tggcgcaccg cggccagcgg ctcggccaga tccgcaccgt cctgcgcgaa       660
     cacggccccg acatcacggc ccgcggggtc gtggagatcg tttacgccga cgtcgacccg       720
     gcggtgtggc ccgcggcgga gtggagcgtc caggcccagc tcacttacct gcgtgaactt       780
     gaagcccccg atggggcttc aagtggcccg caagggccat cggcgtga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page