(data stored in ACNUC1104 zone)

EMBL: AM420293.PE324

AM420293.PE324       Location/Qualifiers
FT   CDS_pept        complement(366669..366884)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99679"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6K5"
FT                   /protein_id="CAL99679.1"
FT                   /translation="MFFTLFMERVEARLRHVAVQENEVEELLENARPDEVRALFRQGIG
FT                   RALELFQLRRVGRAGKLRTRRSRDQS"
     atgttcttca cgctcttcat ggagcgcgtg gaggcacggc tccgccacgt cgcggtacag        60
     gagaacgagg tggaggagct gctggagaac gcccggccgg acgaggtccg ggcgctgttc       120
     cggcagggaa ttggacgtgc gctggagctg ttccagctac gcagggtggg acgcgccggt       180
     aagctgcgga ctcgccgttc ccgcgaccag tcttag                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page