(data stored in ACNUC1104 zone)

EMBL: AM420293.PE33

AM420293.PE33        Location/Qualifiers
FT   CDS_pept        52773..53552
FT                   /transl_table=11
FT                   /locus_tag="SACE_0035"
FT                   /product="rhomboid-like protein"
FT                   /function="uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99388"
FT                   /db_xref="GOA:A4F5R4"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R4"
FT                   /protein_id="CAL99388.1"
FT                   /translation="MGYHCVDCVQAGRGGTRQAVTVAGARLAAKPVVVPVLIAVNVLVH
FT                   VYTSVQAGSGMDNFDSDGFATSALLPILVAGGQWWRLVTSGFLHIGLPHLAMNMIALWV
FT                   IGRDLELVLGRLRFTAVYFLSLLGGSTAVFVFGELVQPVAGASGAVYGLMGGIAVAALR
FT                   LKVSLRPVLIVIGLNVLLSVTIPGLSLLGHLGGLFVGAAATAALVYAPRQRRLLFQGGA
FT                   LAAIFLVLAVALVTKDMSLGNMVCTGYGGAGTRCAVG"
     gtgggctacc actgcgtcga ctgcgtgcag gccggccgcg gtggcacccg ccaggcggtc        60
     acggtcgccg gtgcgcggct ggccgccaag ccggtcgtcg tgccggtgct gatcgcggtc       120
     aacgtgctgg tgcacgtcta cacgtccgtc caggcgggca gcgggatgga caacttcgac       180
     tccgacgggt tcgccacgtc ggcgctgctg ccgatcctgg tcgcgggcgg ccagtggtgg       240
     cggctggtca cctccggctt cctgcacatc ggcctgccgc acctggcgat gaacatgatc       300
     gcgctgtggg tgatcggccg ggacctcgaa ctggtgctgg gccgcctgcg gttcaccgcg       360
     gtctacttcc tgtcgctgct cggcggcagc accgcggtgt tcgtgttcgg cgagctggtg       420
     cagccggtcg ccggcgcgtc cggcgcggtg tacggcctga tgggcggcat cgcggtcgcc       480
     gcactgcggc tgaaggtcag cctgcggccg gtgctcatcg tgatcggcct gaacgtgctg       540
     ctcagcgtca ccatcccggg gctgtccctg ctggggcacc tgggcgggct cttcgtgggc       600
     gccgccgcga cggcggcgct ggtctacgcg ccgaggcagc gcaggctgct cttccagggc       660
     ggcgcgctcg cggcgatctt cctggtgctc gccgtcgcgc tggtcaccaa ggacatgtcg       720
     ctgggcaaca tggtctgcac gggctacggc ggcgcgggca cccgctgcgc cgtgggttag       780
//

If you have problems or comments...

PBIL Back to PBIL home page