(data stored in ACNUC1104 zone)

EMBL: AM420293.PE332

AM420293.PE332       Location/Qualifiers
FT   CDS_pept        374760..375518
FT                   /transl_table=11
FT                   /locus_tag="SACE_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99687"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L3"
FT                   /protein_id="CAL99687.1"
FT                   /translation="MNAQESLLPLLELDGVAEAVTSARAAIDEVHRHPANRRGWPTTAA
FT                   EASVRAARASAAVAGGATEIPETGEVSDPLLAGALRIAEGMGPLLPTWQRAPLQALARL
FT                   HVLAAADLVEDKESLGRPRADREVSERLDLLARIVADSSGKSQGVIPGPVLAAVVHGEL
FT                   LALSPFGLADGVIARAAARLTVIGSGLDPKGLVVPEVAYFRRQGDYSAAADGFANGDPE
FT                   GVGEWLHYCCRALEAGAREAKSIADAVQDA"
     gtgaacgccc aggaatcgct gctcccgttg ctggagcttg acggcgtcgc cgaggcggtg        60
     acctctgctc gcgcggcgat cgacgaggtg caccggcacc cggcgaaccg gcgcggctgg       120
     cccacgacgg ccgccgaggc gtcggtgcga gccgcgcggg cgagcgcggc cgtcgcaggc       180
     ggagcgaccg aaattcccga aacgggtgag gtgagcgacc ccctgctggc gggtgctctg       240
     cgcatcgccg agggcatggg gccgctgctg ccgacgtggc agcgggcccc gctgcaggcg       300
     ctggcccgtc tgcacgtgct cgccgcggcc gatctcgtcg aggacaagga gtcgctgggc       360
     cgtccccgtg ctgatcgcga ggtgtccgag cgcctggacc tgctcgcccg gatcgtcgcc       420
     gactccagcg gcaagtccca gggcgtgatc cccggtccgg tgctggccgc cgtcgtgcac       480
     ggcgagctgc tcgcgctgtc gcccttcggc ctcgccgacg gcgtgatcgc gcgggccgcg       540
     gcgcggctca ccgtgatcgg cagcggcctg gacccgaagg gcctcgtggt gccggaggtg       600
     gcgtacttcc gcaggcaggg cgattactcg gcggcggcgg acggcttcgc caacggcgac       660
     cccgagggcg tcggcgaatg gctccactac tgctgccgcg ccctcgaagc gggcgcgcga       720
     gaggccaagt ccatcgcgga tgctgttcaa gacgcctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page