(data stored in ACNUC1104 zone)

EMBL: AM420293.PE336

AM420293.PE336       Location/Qualifiers
FT   CDS_pept        complement(377628..378974)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0342"
FT                   /product="mandelate racemase/muconate lactonizing enzyme"
FT                   /function="L-alanine-DL-glutamate epimerase"
FT                   /EC_number="4.2.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99691"
FT                   /db_xref="GOA:A4F6L7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR017653"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6L7"
FT                   /protein_id="CAL99691.1"
FT                   /translation="MNTTTTQQSPVVTGMRVVPVAGRDSMLLNLSGAHAPHFTRNLLIL
FT                   TDSAGNTGVGEVPGGEGIRATLTDATDLVVGAPIARYHSVLTHVHRRFADRDSGGRGAQ
FT                   TFDLRVAVHAVTAVEAAMLDLLGKHLGVPVAELLGDGQQRESVPVLGYLFFVGDRNRTD
FT                   LGYRSGAEESDDWLRLRDEEALTSDAVVRLAEAAQARYGFHDFKLKGGVLPGREEAEVV
FT                   TALAERFPEARITLDPNGGWLLSDAIELGRDLYGVLAYAEDPCGPEGGYSGRETMAEFR
FT                   RATGLPTATNMIATDWRQLGHAVRTDAVDIPLADPHFWTMGGSVRVAQLCDAWGLTWGS
FT                   HSNNHFDVSLAMFTHVAAAAPGDITAIDTHWIWQDGQRLTREPFRISDGRIEVPTAPGL
FT                   GVELDMEQVEAAHALYLTEGLGTRDDAVAMRYLVPGWTFDSKRPALDRP"
     atgaacacca cgaccaccca gcagagcccg gtggtgaccg gcatgcgcgt ggtgcccgtc        60
     gccgggcggg acagcatgtt gctcaacctc agcggagcgc acgccccgca cttcacccgc       120
     aacctgctga tcctcaccga ctcggcgggc aacaccggcg tcggcgaggt acccggtggc       180
     gagggcatcc gcgccaccct caccgacgcc accgacctgg tggtgggcgc acccatcgcc       240
     cgctaccact cggtgctgac ccacgtgcac cggcgcttcg ccgaccgcga ctccggcggc       300
     cggggcgcgc agaccttcga cctgcgcgtc gcggtccacg cggtcaccgc ggtcgaggcc       360
     gccatgctcg acctgctcgg caagcacctc ggcgtgccgg tggccgaact gctcggcgac       420
     gggcagcagc gcgagtcggt gccggtgctc gggtacctgt tcttcgtcgg cgaccgcaac       480
     cgcaccgacc tcggctaccg ctcgggcgcc gaggagtccg acgactggct gcggctgcgc       540
     gacgaggagg cgctcacgtc cgatgccgtc gtgcggctgg ccgaggccgc gcaggcgcgc       600
     tacggcttcc acgacttcaa gctcaagggc ggggtgctgc cgggccggga ggaggccgag       660
     gtcgtcaccg cgctcgccga gcggttcccg gaagcgcgga tcaccctcga ccccaacggc       720
     ggctggctgc tgtccgacgc gatcgagctg ggccgcgacc tgtacggggt gctcgcctac       780
     gccgaggacc cgtgcggacc ggagggcggc tactccgggc gcgagacgat ggcggagttc       840
     aggcgggcga ccgggctgcc cacggcgacg aacatgatcg ccaccgactg gcgccagctc       900
     ggacacgccg tgcgcaccga cgccgtcgac atcccgctgg ccgacccgca cttctggacg       960
     atgggcggct cggtgcgcgt ggcccagctc tgcgacgcgt gggggctgac ctggggctcg      1020
     cactccaaca accacttcga cgtgtcgctg gcgatgttca cccacgtcgc cgccgcggcg      1080
     ccgggcgaca tcaccgcgat cgacacgcac tggatctggc aggacgggca gcggctgacc      1140
     cgcgagccgt tccggatcag cgacgggcgc atcgaggtgc ccaccgctcc cgggctcggg      1200
     gtggagctgg acatggagca ggtggaggcc gcgcacgcgc tctacctcac cgaggggctc      1260
     ggcacgcgcg acgacgccgt cgcgatgcgc tacctcgtgc cgggctggac cttcgacagc      1320
     aagcgcccgg ctctcgaccg tccctga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page