(data stored in ACNUC1104 zone)

EMBL: AM420293.PE34

AM420293.PE34        Location/Qualifiers
FT   CDS_pept        complement(53632..54045)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99389"
FT                   /db_xref="GOA:A4F5R5"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R5"
FT                   /protein_id="CAL99389.1"
FT                   /translation="MRSQISREWSTPVGLAASGWVLTAAAVAWWLLSGSAPDRLFVGAV
FT                   VVVLAAASAYATLCRPRLSADAAGITVRGLRGRRSWPWAAVTVRTERSSRLGRTVEVLV
FT                   LDTADDELVVLTRLELGADPVEVADALNAMRPG"
     gtgcgttccc agatttcgcg tgagtggtcc acacccgtcg gcctggccgc ttccgggtgg        60
     gtgctcaccg cggccgcggt tgcgtggtgg ctgctgagcg gcagcgcgcc ggaccggctg       120
     ttcgtcggcg cggtggtggt cgtgctcgcg gccgcctcgg cctacgccac gctctgccgg       180
     ccgcggctca gcgccgacgc cgcaggcatc accgtgcgcg gtctgcgcgg ccgcaggtcg       240
     tggccgtggg cggcggtgac cgtgcggacc gagcgcagct cgcggctcgg ccgcaccgtc       300
     gaggtgctcg tcctcgacac cgccgacgac gagctcgtgg tgctgaccag gctcgaactc       360
     ggcgccgatc cggtcgaggt cgcggacgcg ttgaacgcga tgcgacccgg ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page