(data stored in ACNUC1104 zone)

EMBL: AM420293.PE343

AM420293.PE343       Location/Qualifiers
FT   CDS_pept        385521..386045
FT                   /transl_table=11
FT                   /locus_tag="SACE_0349"
FT                   /product="cysteine dioxygenase type I"
FT                   /function="predicted metal-dependent enzyme of the
FT                   double-stranded beta helix superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99698"
FT                   /db_xref="GOA:A4F6M4"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M4"
FT                   /protein_id="CAL99698.1"
FT                   /translation="MTPQQIHLVQAIRDVVRREERAERTAELVAEALRPFLAVPDLLRE
FT                   DQRTGDPGSYTQHVLHVEPDGSFSVVALVWLPGQRTPVHDHVAWCVTGVYEGVEHEQRF
FT                   TVHDGSSLVPTQQVTNPAGDVCGFAPPGDIHLVRNACTTKAISLHVYGADIGTLGTSVR
FT                   RTYDLPVRAAV"
     atgactccgc agcagatcca cctggtgcag gccatccgcg acgtcgtccg gcgcgaggag        60
     cgcgcggagc ggacggcgga actggtcgcc gaggcactgc ggccgttcct cgcggtgccg       120
     gacctgctgc gcgaggacca gcgcaccggc gaccccggca gctacacgca gcacgtcctg       180
     cacgtcgaac ccgacggatc gttctccgtc gtcgcgctgg tctggctccc cggccagcgg       240
     accccggtgc acgaccacgt cgcctggtgc gtcaccggcg tctacgaggg cgtcgagcac       300
     gagcagcgct tcaccgtgca cgacggcagc tcgctggtgc cgacccagca ggtgaccaac       360
     cccgcgggcg acgtctgcgg cttcgccccg cccggcgaca tccacctggt gcgcaacgcc       420
     tgcaccacca aggccatctc cctgcacgtc tacggcgccg acatcggcac cctcggcacc       480
     agcgtccggc gcacctacga cctgcccgtc cgggcggcgg tctag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page