(data stored in ACNUC1104 zone)

EMBL: AM420293.PE344

AM420293.PE344       Location/Qualifiers
FT   CDS_pept        complement(386052..386840)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99699"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M5"
FT                   /protein_id="CAL99699.1"
FT                   /translation="MSERWRLPPLWFELCWEVGGFGDRPIPVGGSTDEWTPQERVVLRQ
FT                   RALAGMRAAGLLSGDVLAPALAQALAQIARPCLWIDGAWLPVAGSPPARLLSVVAGSGT
FT                   VLLVSGGADAQDVDISVHPRTSISAAAARGIPQAPPGLRAFVSVPASAFEPWEEDSESV
FT                   GGGPGDAGGGGPGSEPTLREMIDAPHFREGRFTANLRARSGRTHRSQPLNWFDAFQPDG
FT                   RYRLRHGLGRRNELGLTPLSPADITHALDRRIAAVVRAGG"
     gtgtccgagc gatggcgcct gccaccgctg tggttcgaac tgtgctggga ggtcggcgga        60
     ttcggcgacc gcccgatccc ggtcggcggc tccaccgacg agtggacgcc gcaggagcgg       120
     gtggtgctcc ggcagcgtgc gctggccggg atgcgcgccg ccggtctgct gtcgggggac       180
     gtgctggcgc ccgccctggc acaggcactc gcgcagatcg ccaggccgtg cctgtggatc       240
     gacggcgcgt ggctgcccgt cgcgggcagt ccgcccgcca ggctgctgtc ggtcgtcgcg       300
     ggcagcggaa cggtcctgct ggtgagcggc ggggccgacg cgcaggatgt cgacatctcc       360
     gtgcacccgc gcacgtcgat ctctgccgcc gcggcgcggg gcatcccgca ggcgccgcca       420
     ggactgcgcg cgttcgtgtc cgtcccggcg agcgctttcg agccgtggga ggaggactcg       480
     gagagcgttg gtggtggtcc aggcgatgcc ggcggtggcg gtcccggctc ggagccgacg       540
     ctgcgggaga tgatcgacgc gccgcacttc cgcgagggcc ggttcaccgc gaacctgcgc       600
     gcccgcagcg gccgaacgca ccgctcgcag ccgctcaact ggttcgacgc cttccagccc       660
     gacggccgct accgcctgcg gcacggactc ggccgccgca acgaactcgg gctcacaccg       720
     ctgagcccgg ccgacatcac ccacgccctc gaccggcgca tcgccgccgt cgtccgggcg       780
     ggcggctag                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page