(data stored in SCRATCH zone)

EMBL: AM420293.PE346

AM420293.PE346       Location/Qualifiers
FT   CDS_pept        complement(387958..388875)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0352"
FT                   /product="putative phophosugar-binding protein"
FT                   /function="predicted sugar phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99701"
FT                   /db_xref="GOA:A4F6M7"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M7"
FT                   /protein_id="CAL99701.1"
FT                   /translation="MRDTERAVRVESPTERSNPRTKDIDLLPTLDILHLLNSEDRTVPA
FT                   AVGRALPELARAVDMAVSALRGGGRVHYVGAGTSGRLAVLDAAELIPTFNVPPNWFVAH
FT                   QAGGAGAFQRAVENAEDNADAGAATIEAEATGADFVLGLAASGRTPFVMGALDAARRMG
FT                   AGTGLVSANPESAASSPAEVVIAVDTGPEPITGSTRMKAGTAQKLVLTSFSTSVMIRLG
FT                   RTYSNLMVSMLATNAKLRGRTISILREATNAPEADCEAALTAADGDLKTALVHLLTGVD
FT                   VERASAALAVSDGHVREAMRSLNA"
     atgagggaca ccgagcgcgc ggtgcgggtc gaatccccga ccgaacggtc caaccccagg        60
     accaaggaca tcgacctgct gcccacgctc gacatcctgc acctgctgaa ctccgaggac       120
     cgcaccgtcc cggcggccgt gggccgggcg ctgccggagc tggcgcgcgc cgtcgacatg       180
     gccgtcagcg cgctgcgcgg cggcgggcgc gtgcactacg tcggcgcggg cacctccggg       240
     cggctggcgg tcctcgacgc cgccgagctc atccccacct tcaacgtgcc gccgaactgg       300
     ttcgtcgcgc accaggcagg cggtgccggc gcgttccagc gggcagtaga gaacgccgag       360
     gacaacgccg acgcgggcgc cgcgacgatc gaggccgagg ccaccggcgc cgacttcgtg       420
     ctcggcctgg cggcctcggg ccgcaccccg ttcgtcatgg gcgcgctcga cgcggcgcgg       480
     cggatgggcg cgggcaccgg tctggtctcg gccaaccccg agtccgcagc gagctccccg       540
     gccgaggtgg tgatcgccgt cgacaccggc ccggaaccga tcaccggctc gaccaggatg       600
     aaggcgggca ccgcgcagaa gctggtgctc acgtcgttct cgacctcggt gatgatccgg       660
     ctcggccgca cctactccaa cctgatggtg agcatgctcg ccacgaacgc gaagctgcgc       720
     gggcgcacga tcagcatcct gcgggaggcc accaacgccc cggaagccga ctgcgaggcg       780
     gcgctgaccg ccgccgacgg cgacctcaag accgcgctgg tgcacctgct gacgggggtc       840
     gacgtcgagc gcgcctcggc cgcgctcgcg gtctccgacg gtcacgtgcg cgaggcgatg       900
     aggtcgctca acgcgtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page