(data stored in SCRATCH zone)

EMBL: AM420293.PE348

AM420293.PE348       Location/Qualifiers
FT   CDS_pept        389982..391610
FT                   /transl_table=11
FT                   /locus_tag="SACE_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99703"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6M9"
FT                   /protein_id="CAL99703.1"
FT                   /translation="MPPELFCAAGWSPKRVLEHEEFLLQQHEAGALRLHDRGELGGAGP
FT                   PLRRWRMSWPRDGATVHAVLATIDIPGHDDAAKVWFGAHCELGWGWDAPSPLIRPGLGQ
FT                   QVLVDPANALAATGSSMFSGEDALEQPLAVIRDRATRMPVLFRHGREAGAHRARTFRGA
FT                   TLGAVGMVGLDDDAARRLAAELPAERRIPERGARLVLPSWWEPHQPDICVPADEIDDDA
FT                   AWRALADAALRAARWRPDGPMPVDDEWWRALFEGAWNDERVAAPSGSGGARWYAVRDGA
FT                   DKAQLRQRIQGVGDSVAELRSARTRRESALAELESDIERHREELRALTRSRTALARGVL
FT                   RLRAERDAARAELDGTSLGAALRRTKAAQRLVRARSAELHRREEMLADLHRPADGADAS
FT                   AEALGDHAESSGHDTGDVVRGDLDEQPARRVAAAPPVATVVLAPGVEDEVERLDDARRR
FT                   RCRRVLHLLGSAGGDVARHLRDAGVSPLRLGTTADPGAALTFRTADGDWRPFAHHVLLD
FT                   HSGHHVLHYRRDGDVVHVGYVGPAL"
     gtgccgccgg agctgttctg cgccgcgggc tggtccccga agcgggtgct ggagcacgag        60
     gagttcctgc tccagcagca cgaggcgggc gcgctgcgcc tgcacgaccg cggtgagctg       120
     ggcggcgcgg ggccgccgct gcggcgctgg cggatgagct ggccgcgcga cggcgcgacc       180
     gtccacgccg tcctcgccac catcgacatc ccaggccacg acgacgcggc gaaggtctgg       240
     ttcggcgcgc actgcgagct cggctggggg tgggacgcgc cgtcgccgtt gatccgcccc       300
     ggactcgggc agcaggtgct cgtcgacccc gcgaacgcgc tggccgccac cggatcgtcg       360
     atgttcagcg gcgaggacgc gctggagcag ccgctggcgg tcatccgcga ccgcgccacc       420
     cggatgccgg tgctgttccg ccacggccgc gaggccggcg cccaccgggc gcgcaccttc       480
     cgcggcgcga cgctcggcgc ggtcggcatg gtcggcctcg acgacgacgc cgcccgcagg       540
     ctcgccgcgg aactgcccgc cgagcgccgg attcccgaac gcggcgcccg gctggtcctc       600
     ccgagctggt gggagccgca ccagccggac atctgcgtgc ctgccgacga gatcgacgac       660
     gacgcggcgt ggcgggcgct ggccgacgcg gcattgcgcg cggcccgctg gcgtccggac       720
     ggaccgatgc cagtggacga cgagtggtgg cgtgcgttgt tcgagggcgc gtggaacgac       780
     gagcgggtgg ccgccccctc cggcagcggt ggcgcgcgct ggtacgcggt ccgggacggc       840
     gccgacaagg cgcagctgcg ccagcgcatc cagggcgtcg gtgacagcgt cgcggagctg       900
     cgcagcgcgc ggactcgccg cgaaagcgcc ctcgccgaac tggagagcga catcgaacgg       960
     catcgggagg agttgcgtgc gctcacgcgt tcgcgcacgg cgttggcgcg cggcgtgctg      1020
     cgtctgcgtg cggagcgcga cgctgcacgg gcggagctcg acgggacgtc gcttggcgcg      1080
     gcgctgcgcc gcaccaaggc cgcgcaacga ctagtgcgag cccgctcggc ggaactgcac      1140
     cggcgcgagg aaatgctcgc ggacctgcac cgcccggccg acggggccga cgcctcagcc      1200
     gaggctctcg gcgaccacgc cgaaagttct ggtcacgaca ccggagacgt tgtccggggt      1260
     gacctcgacg agcagcctgc ccgccgggtc gccgccgctc cacccgtcgc gaccgtggtg      1320
     ctcgcgcccg gtgtcgaaga cgaggtcgag cgcctcgacg acgcccgccg ccggcgctgc      1380
     cgccgggtgc tgcacctgct cggctccgcc gggggcgacg tcgcgcggca cctgcgcgat      1440
     gcgggtgtgt ccccgctgcg gctgggcacc acggccgacc ccggcgccgc gctgaccttc      1500
     cggaccgccg acggcgactg gcggcccttc gcccaccacg tgctgctcga ccacagtgga      1560
     caccacgtgc tgcactaccg ccgggacggc gacgtcgtgc acgtcgggta cgtggggccc      1620
     gcgctgtga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page