(data stored in SCRATCH zone)

EMBL: AM420293.PE349

AM420293.PE349       Location/Qualifiers
FT   CDS_pept        391607..393388
FT                   /transl_table=11
FT                   /locus_tag="SACE_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99704"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N0"
FT                   /protein_id="CAL99704.1"
FT                   /translation="MTPEPLPPTSFCAAGHASASLLEHERTLVALHESGALRLIDGGRE
FT                   GSGRRWRMSWGHGSSAVRAMVGVRESATDDGEVTFWVHAEARRPWSIRDQRNPVERMGL
FT                   LDHGLKDPSSAYSLTQQNPLFGLREVGFLEHTFSRDMRDSPVLVYHDEPGARPSQEMRR
FT                   FRNATRGMCGLLPVDDAVRERVNDLVPADRRIPHRAVRLYVPPWWAGHEEDITVEVSRL
FT                   DRPGVWRRIVDTVIRVSSWRGGGKIRATAREWSALLDDPMNDVRIVPATRGGDVRWLPA
FT                   PDDSGKRILRRRLDAVTEQARTARDEADSAAESVARRRATLDALTAQVALARRSRRRLA
FT                   ELTLRLRQERDSAEAALRTGSVAAAWREAREAELEAELYAEELDRVDDEVVAQRSRARA
FT                   AAGGGAARGAEPAEPDGGGARAARSAPSFTGFGELLAAAERELAGLRLGPQTAVAVELD
FT                   GHLRSALWRRRTWDVLELLSAYALRRRAADGGEPCLRGFSYYVREFGGTRGISPSLVAS
FT                   GESEMVANTPRFRNARTFAVPPEVHRSGWEFFGAHVKIDRGGGVAPRLHYFDDTRGPTG
FT                   EVHIGYLGPHLPSPESN"
     gtgactcccg aaccgctccc gccgacgtcc ttctgcgccg cgggccacgc ctcggcgtcg        60
     ctgctcgaac acgagcggac gctcgtcgcg ctgcacgagt ccggtgcgct ccggctcatc       120
     gacggcggcc gcgagggctc aggccgccgc tggcggatgt cctggggcca cggctcgtcg       180
     gccgtgcggg cgatggtcgg cgtgcgggag agcgccaccg acgacggcga ggtcaccttc       240
     tgggtccacg ccgaggccag gcgcccgtgg tcgatccgcg accagcgcaa cccggtcgaa       300
     cgcatgggcc tgctcgacca cggcctgaag gacccgagct cggcctactc gctcacccag       360
     cagaacccgc tgttcggcct gcgggaggtc gggttcctcg aacacacctt cagccgcgac       420
     atgcgcgact cgcccgtgct ggtctaccac gacgaaccgg gcgcccggcc gagccaggag       480
     atgcggcgct tccgcaacgc gaccaggggc atgtgcgggc tgctgccggt ggacgacgcg       540
     gtccgcgagc gcgtcaacga cctggtgccc gccgaccggc gcatcccgca ccgcgctgtg       600
     cgcctctacg tgccgccgtg gtgggccggc cacgaggagg acatcacggt cgaagtgtcc       660
     cggctcgacc gcccgggcgt gtggcggcgg atcgtcgaca ccgtgatccg ggtgagctcg       720
     tggcgcggtg gcggcaagat ccgcgccacc gcgcgggagt ggtcggcgct gctggacgac       780
     cccatgaacg acgtgcggat cgtgcccgcc acgcgcggcg gcgacgttcg ctggctcccg       840
     gcccccgacg acagcggcaa gcgcatcctg cgcagacgcc tcgacgccgt caccgaacag       900
     gccaggacgg cccgggatga ggccgacagc gccgccgagt cggtggcccg ccgccgcgcc       960
     accctggacg ccctgaccgc ccaggtcgcg ctcgcccggc ggtcgaggcg gcggctggcc      1020
     gaactcacgc tgcggctgcg gcaggagcgc gacagcgcgg aggccgcgct gcggacgggc      1080
     tcggtcgcgg cggcgtggcg cgaagcgcgc gaggcggaac tcgaagcgga gctctacgcc      1140
     gaggagctgg accgcgtcga cgacgaagtc gtcgcgcagc ggtccagggc gcgggccgcc      1200
     gccggaggcg gggcggcgcg cggcgccgag ccggcggagc cggacggcgg tggagcgcgg      1260
     gcggcgcgga gcgcgccgag cttcaccggc ttcggcgagc tgctggcggc ggcggagcgg      1320
     gagctcgccg ggctgcggct cgggccgcag accgcggtgg cggtcgagct ggacggccac      1380
     ctgcggtcgg cgctgtggcg gcgccgcacc tgggacgtgc tcgaactgct ctccgcctac      1440
     gccctgcgcc gccgcgcggc cgacggcggc gaaccctgcc tgcgcgggtt ctcctactac      1500
     gtgcgggagt tcggggggac gcgcgggatc agcccgagcc tggtggcctc cggcgagagc      1560
     gaaatggtgg ccaacacgcc gcgcttccgc aacgcccgca ccttcgcggt cccgccggag      1620
     gtccaccgct cgggctggga gttcttcggc gcccacgtca agatcgaccg gggcggtggg      1680
     gtcgccccgc ggctgcacta cttcgacgac acccgcggcc cgaccggcga ggtccacatc      1740
     ggctacctcg gcccccacct ccccagcccg gagagcaact ga                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page