(data stored in ACNUC1104 zone)

EMBL: AM420293.PE35

AM420293.PE35        Location/Qualifiers
FT   CDS_pept        complement(54265..54531)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99390"
FT                   /db_xref="GOA:A4F5R6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A4F5R6"
FT                   /protein_id="CAL99390.1"
FT                   /translation="MPKSKVRKKDSSTPVADRRTPVKAKAVGPSHPIYVVVMLGMMVIG
FT                   LLWLVVNYLAGDKIPFMADLEAWNFAVGFAFMIIGLLMTMRWR"
     atgccgaagt ccaaagtccg caagaaggac tcctccaccc cggtggctga tcgccgcacg        60
     ccggtgaagg cgaaggcggt aggaccgtcg cacccgatct acgtcgtggt catgctgggc       120
     atgatggtca tcggcctgct gtggctggtg gtcaactacc tggcggggga caagatcccg       180
     ttcatggccg acctggaggc gtggaacttc gcggtcgggt tcgctttcat gatcatcggc       240
     ctgctgatga ccatgcgctg gcgctag                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page