(data stored in ACNUC1104 zone)

EMBL: AM420293.PE351

AM420293.PE351       Location/Qualifiers
FT   CDS_pept        complement(393881..394384)
FT                   /transl_table=11
FT                   /locus_tag="SACE_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99706"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6N2"
FT                   /protein_id="CAL99706.1"
FT                   /translation="MDPAPFRTDVSLHRNGTGRPTLRFERHYRHPKEQVWRALTEEAEL
FT                   AAWFPCAARIDATPGGTATFTFPGAPPQSGEVLAAEPPRSLDFTWHGETLRWRLADAPG
FT                   GCLLRLDIENQDPAHAAQSAAGYDLCLDQLATLLDAGSVRRVEMPPPREIVQHYADAFS
FT                   VPDA"
     gtggatcccg cacccttccg caccgacgtg agcctgcacc gcaacggcac cgggcgcccg        60
     acgctgcgct tcgaacgcca ctaccgccac ccgaaggagc aggtgtggcg ggcgctcacc       120
     gaggaagccg agctcgccgc ctggttcccc tgcgccgcgc gcatcgacgc gacgccgggt       180
     ggcaccgcga cgttcacctt cccgggtgcc ccgccccagt ccggcgaggt gctggcggcg       240
     gagccgccgc gctcgctgga cttcacctgg cacggcgaaa cgctgcggtg gcggctggcc       300
     gacgctccgg gcggatgcct gctgcggctg gacatcgaga accaggaccc cgcccacgcc       360
     gcccagtcgg ccgccgggta cgacctgtgc ctcgaccagc tcgccacgct gctcgacgcg       420
     gggtcggtcc ggcgcgtcga gatgcccccg ccgcgggaaa tcgtccagca ctacgcggac       480
     gcgttctccg tgccggatgc ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page