(data stored in SCRATCH zone)

EMBL: AM420293.PE360

AM420293.PE360       Location/Qualifiers
FT   CDS_pept        404965..406098
FT                   /transl_table=11
FT                   /locus_tag="SACE_0367"
FT                   /product="type II secretion system protein E"
FT                   /function="Flp pilus assembly protein, ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:SACE_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAL99715"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4F6P1"
FT                   /protein_id="CAL99715.1"
FT                   /translation="MRNRLAGSGVPLTSSAVATAVRAEAGGLVGDADVLDRLRQVQREF
FT                   LGAGALEPLLRDPAVTDVLVTAPDAVWVDQGDGLRRCTETFADEDAVRRLAQRLALASG
FT                   RRLDDAQPWVDAWLPRATGAVRLHAVLPPVADSTCISLRVLRPAVHGLDSLHGKDMFDA
FT                   PTAELLRSIIATRLAFLVVGGAGAGKTTLLAAMLGEVSPAERIICVEEASELQPDHPHV
FT                   VRLLTRPPNIEGAGEIQVRDLVRQALRMRPDRLVVGEVRGGEICELLAALNTGHEGGGG
FT                   TLHANSPREVPARMEALAALGGLSRAALHSQLAAAVQVVLHVQRTRQGRRLAAVGVPFR
FT                   VGDHIEVRPAWEQHSGWGPGAEALAAMLSARGGALPC"
     gtgcgcaacc ggctcgcggg cagcggcgtg ccgctgacgt cgtccgcggt ggccacggcg        60
     gtgcgggcgg aagcaggcgg gctggtcggc gacgccgacg tgctcgaccg gctccgccag       120
     gtgcagcgcg agttcctcgg ggccggtgcg ctcgaaccgc tgctgcgcga cccggcggtc       180
     accgacgtgc tggtcaccgc gcccgacgcg gtgtgggtcg accagggcga tggactgcgg       240
     cgctgcacgg agaccttcgc cgacgaggac gccgtgcggc gcctcgcgca gcgactggca       300
     ctggccagcg gccgcaggct cgacgacgcg caaccgtggg tcgacgcctg gctgccccgc       360
     gcgaccggcg ccgtccggct gcacgcggtg ctgccgccgg tggccgacag cacctgcatc       420
     tcgctgcggg tcctgcgtcc ggcggtgcac ggcctcgact ccctgcacgg caaggacatg       480
     ttcgacgcgc cgaccgccga actgctgcgc tcgatcatcg ccacccggct ggccttcctc       540
     gtcgtcggag gtgcgggagc gggcaagacc acgctgctcg cggcgatgct cggggaggtc       600
     agccccgccg agcgcatcat ctgcgtcgag gaggccagcg agctgcaacc cgaccacccg       660
     cacgtggttc gcctgctgac ccggccaccg aacatcgagg gtgcggggga gatccaggtg       720
     cgcgatctcg tgcgccaggc cctccggatg cgaccggacc gcctggtcgt cggcgaggtg       780
     cgcggcggcg agatctgcga gctgctggcc gcgctcaaca ccgggcacga agggggcggc       840
     ggcaccctgc acgcgaactc gccccgcgag gtgcccgcgc gaatggaggc actggccgcg       900
     ctcggcggtc tctcccgtgc cgcgctgcac agccagctgg ccgccgcggt ccaggtcgtc       960
     ctccacgtcc agcggacgcg gcagggccgc aggctggccg cggtgggcgt gccgttccgc      1020
     gtgggcgacc acatcgaggt ccgcccggcg tgggagcagc actccggttg gggaccgggc      1080
     gcggaagcgc tcgcggcgat gctctccgcg cggggaggtg cgttgccgtg ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page